Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized glycosyltransferase ydaM (ydaM)

This Recombinant Bacillus subtilis Uncharacterized glycosyltransferase ydaM (ydaM) spans the amino acid sequence from region 1-420.

Product Specifications

Product Name Alternative

Uncharacterized glycosyltransferase ydaM, EC= 2.4.-.-

UniProt

P96587

Expression Region

1-420

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGNTLFFISLSLIWVMLLYHMFLMQGGFRHYMTFERNIPKWRENMKELPKVSVLIPAHNE EVVIRQTLKAMVNLYYPKDRLEIIVVNDNSSDRTGDIVNEFSEKYDFIKMVITKPPNAGK GKSSALNSGFAESNGDVICVYDADNTPEKMAVYYLVLGLMNDEKAGAVVGKFRVINAAKT LLTRFINIETICFQWMAQGGRWKWFKIATIPGTNFAIRRSIIEKLGGWDDKALAEDTELT IRVYNLGYHIRFFPAAITWEQEPETWKVWWRQRTRWARGNQYVVLKFLAQFFKLKRKRII FDLFYFFFTYFLFFFGVIMSNAIFVVNLFYDLHLSVGFLAMILWILAFFLFMTEVMITLS IEKTEMNKQNFFIVFLMYFTYSQAWIVLVIYSLFVEIKHRLFKQEVKWYKTERYNQHKSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rab3A+Rab3B+Rab3C+Rab3D Rabbit Polyclonal Antibody (PerCP)
orb2402734 100 µL

Rab3A+Rab3B+Rab3C+Rab3D Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Transglutaminase 4 Rabbit Polyclonal Antibody (HRP)
orb472253 100 µL

Transglutaminase 4 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Recombinant Human STAP1 Protein
E30P70113A 50 µg

Recombinant Human STAP1 Protein

Sign In for Pricing
View Details
SFRS9 Rabbit Polyclonal Antibody (BF555)
orb2491231 100 µL

SFRS9 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
PRSS1 antibody
70R-10213 100 µL

PRSS1 antibody

Sign In for Pricing
View Details
DCAKD (Dephospho-CoA Kinase Domain-containing Protein, FLJ22955) (HRP)
125658-HRP 100 µL

DCAKD (Dephospho-CoA Kinase Domain-containing Protein, FLJ22955) (HRP)

Sign In for Pricing
View Details