Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Corynebacterium glutamicum Membrane protein insertase YidC (yidC)

This Recombinant Corynebacterium glutamicum Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 1-422.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

Q8NLK2

Expression Region

1-422

Origin

Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLDILIYPVSGVMKLWHLLLHNVAGLDDSLAWFFSLFGLVITIRAIIAPFTWQMYKSGRT AAHIRPHRAALREEYKGKYDEASIRELQKRQNDLNKEYGINPLAGCVPGLIQIPIVLGLY WALLRMARPEGGLENPVFQSIGFLTPEEVESFLAGRVSNVPLPAYVSMPTEQLKYLSTTQ AEVLSFVLPLFITAAILTAINMAMSMYRSFQTNDYASGFSNGMLKFMIVMSILAPIFPLS LGLTGPFPTAIALYWVSNNLWTLLQTIIMMVILERKYPLTDDFKVHHLEQRDIYRAKQKE KRIFLWTRRKNRALMILTPWNASTLHATNVELTKTRTAEINEAKQARKEIANKRRETQRE MNRAAMQRLKQRRAEVKAKKKGLIDASPNEDTPSENEETKLSSPQVEPTTTAEPNREPSQ ED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Colony Stimulating Factor 2, Granulocyte Macrophage (GM-CSF)
SIPA028Ra01-01 10 µg

Recombinant Colony Stimulating Factor 2, Granulocyte Macrophage (GM-CSF)

Sign In for Pricing
View Details
Recombinant Colony Stimulating Factor 2, Granulocyte Macrophage (GM-CSF)
SIPA028Ra01-02 50 µg

Recombinant Colony Stimulating Factor 2, Granulocyte Macrophage (GM-CSF)

Sign In for Pricing
View Details
Recombinant Colony Stimulating Factor 2, Granulocyte Macrophage (GM-CSF)
SIPA028Ra01-03 200 µg

Recombinant Colony Stimulating Factor 2, Granulocyte Macrophage (GM-CSF)

Sign In for Pricing
View Details
Recombinant Colony Stimulating Factor 2, Granulocyte Macrophage (GM-CSF)
SIPA028Ra01-04 1 mg

Recombinant Colony Stimulating Factor 2, Granulocyte Macrophage (GM-CSF)

Sign In for Pricing
View Details
Recombinant Colony Stimulating Factor 2, Granulocyte Macrophage (GM-CSF)
SIPA028Ra01-05 5 mg

Recombinant Colony Stimulating Factor 2, Granulocyte Macrophage (GM-CSF)

Sign In for Pricing
View Details
FGF21 Antibody
orb1323334 100 µL

FGF21 Antibody

Sign In for Pricing
View Details