Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Ring finger protein 26 (Rnf26)

This Recombinant Mouse Ring finger protein 26 (Rnf26) spans the amino acid sequence from region 1-424.

Product Specifications

Product Name Alternative

Ring finger protein 26

UniProt

Q8BUH7

Expression Region

1-424

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEAVYLVVNGVGLVLDLLTLMLDLNFLLVSSLLATLAWLLAFIYNLPHTVLTSLLHLGRG FLLSLLALVEAVVRFTFGGLQALGTLLYSCYSGLESLKLLGHLASHGALRSREFLNRGIL NMVSNGHALLRQACDICAIAMSLVAYVINSLVNICLISTQNFFSLVLALWDAVTGPLWRM TDVVAAFLAHISSSAVAMAILLWTPCQLALELLASAARLLASCVVFHLTGLVLLACVLAV ILIVLHPEQTLRLATQALSQLHARPSYHRLWEDIVRLTRLPLGLEAWRRVWSRSLQLASW PNRGGAPGAPQGGPRRVFSARIQPQDTPPEAEEEVIRTAPARGREQLNEDEPAAGQDPWK LLKEQEERKKCVICQDQSKTVLLLPCRHLCLCQACTEILMRHPVYHRNCPLCRRSILQTL NVYL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat anti-Defensin, beta 19 (mouse) Antibody
dAP-2539 50 µg

Goat anti-Defensin, beta 19 (mouse) Antibody

Sign In for Pricing
View Details
PSMB11, CT (PSMB11, Proteasome subunit beta type-11, Proteasome subunit beta-5t) (MaxLight 550)
MBS6338190-01 0.1 mL

PSMB11, CT (PSMB11, Proteasome subunit beta type-11, Proteasome subunit beta-5t) (MaxLight 550)

Sign In for Pricing
View Details
PSMB11, CT (PSMB11, Proteasome subunit beta type-11, Proteasome subunit beta-5t) (MaxLight 550)
MBS6338190-02 5x 0.1 mL

PSMB11, CT (PSMB11, Proteasome subunit beta type-11, Proteasome subunit beta-5t) (MaxLight 550)

Sign In for Pricing
View Details
Anti-SLC2A1 Polyclonal Antibody 3
TMAB-01711-01 50 μL

Anti-SLC2A1 Polyclonal Antibody 3

Sign In for Pricing
View Details
Anti-SLC2A1 Polyclonal Antibody 3
TMAB-01711-02 100 µL

Anti-SLC2A1 Polyclonal Antibody 3

Sign In for Pricing
View Details
Anti-SLC2A1 Polyclonal Antibody 3
TMAB-01711-03 200 µL

Anti-SLC2A1 Polyclonal Antibody 3

Sign In for Pricing
View Details