Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana DUF21 domain-containing protein At4g33700 (CBSDUF6)

This Recombinant Arabidopsis thaliana DUF21 domain-containing protein At4g33700 (CBSDUF6) spans the amino acid sequence from region 1-424.

Product Specifications

Product Name Alternative

DUF21 domain-containing protein At4g33700, CBS domain-containing protein CBSDUF6

UniProt

Q8VZI2

Expression Region

1-424

Origin

Arabidopsis thaliana (Mouse-ear cress)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVEYVCCSPNFFIHIAVIVFLVLFAGLMSGLTLGLMSLSLVDLEVLAKSGTPEHRKYAA KILPVVKNQHLLLVTLLICNAAAMETLPIFLDGLVTAWGAILISVTLILLFGEIIPQSIC SRYGLAIGATVAPFVRVLVFICLPVAWPISKLLDFLLGHRRAALFRRAELKTLVDFHGNE AGKGGELTHDETTIIAGALELSEKMVKDAMTPISDIFVIDINAKLDRDLMNLILEKGHSR VPVYYEQPTNIIGLVLVKNLLTINPDEEIPVKNVTIRRIPRVPEILPLYDILNEFQKGLS HMAVVVRQCDKIHPLPSKNGSVKEARVDVDSEGTPTPQERMLRTKRSLQKWKSFPNRASS FKGGSKSKKWSKDNDADILQLNGNPLPKLAEEEEAVGIITMEDVIEELLQEEIFDETDHH FEDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL
BNC470630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF647 conjugate, 0.1mg/mL
BNC470029-100 1x 100 µL

Fibronectin (TV-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF640R conjugate, 0.1mg/mL
BNC400151-100 1x 100 µL

CD11a (Cris-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Vitronectin Receptor / CD51 / CD61 (23C6), CF405S conjugate, 0.1mg/mL
BNC041471-500 1x 500 µL

Vitronectin Receptor / CD51 / CD61 (23C6), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1527), CF647 conjugate, 0.1mg/mL
BNC471527-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1527), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prostate Specific Acid Phosphatase (PSAP) (rACPP/1338), CF647 conjugate, 0.1mg/mL
BNC472074-500 1x 500 µL

Prostate Specific Acid Phosphatase (PSAP) (rACPP/1338), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details