Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Adenylate cyclase 1 (cyaA)

This Recombinant Adenylate cyclase 1 (cyaA) spans the amino acid sequence from region 1-424.

Product Specifications

Product Name Alternative

Adenylate cyclase 1, EC= 4.6.1.1, ATP pyrophosphate-lyase 1, Adenylyl cyclase 1, AC 1

UniProt

P40137

Expression Region

1-424

Origin

Stigmatella aurantiaca

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMDAAGRTTQETLARTLESEQGHNALNLSWVRLLATSAVLIVSLYFGRVRGMTDWDVYTP PFAAYWSVTALTLVALYRFERLRRWAGLSLALVDVPAIYWLQHIALPLSPSPGGVAGFTL GLYATLILLSALSLRRTMTLVVTACAAVGEVALQREAHISLGAQLTAVVVLGACAAGACH LLLRIRTLLTTATQQELKRARLGRYFSPAVAERLQDLDRSETSPELREVTLLFADIRDFT SLSERLRPEQVVTLLNEYYGRMVEVVFRHGGTLDKFIGDALMVYFGAPIADPAHARRGVQ CALDMVQELETVNALRSARGEPCLRIGVGVHTGPAVLGNIGSATRRLEYTAIGDTVNLAS RIESLTKTRDVPILASRATREQAGDTFLWNEMAPASVPGKSQPVAIFTPRNRTPAQQAGA PAAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-human Nuclear nucleic acid-binding protein C1D polyclonal Antibody, Biotin conjugated
MBS715617-01 0.05 mg

Rabbit anti-human Nuclear nucleic acid-binding protein C1D polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti-human Nuclear nucleic acid-binding protein C1D polyclonal Antibody, Biotin conjugated
MBS715617-02 0.1 mg

Rabbit anti-human Nuclear nucleic acid-binding protein C1D polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti-human Nuclear nucleic acid-binding protein C1D polyclonal Antibody, Biotin conjugated
MBS715617-03 5x 0.1 mg

Rabbit anti-human Nuclear nucleic acid-binding protein C1D polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
SRPX (NM_001170750) Human Tagged ORF Clone Lentiviral Particle
RC230091L4V 200 µL

SRPX (NM_001170750) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
(3S,5S,6R) -3-[ (3R) -4-Bromo-3-hydroxybutyl]-2-oxo-5,6-diphenyl-4-morpholinecarboxylic Acid tert-Butyl Ester
160925 10 mg

(3S,5S,6R) -3-[ (3R) -4-Bromo-3-hydroxybutyl]-2-oxo-5,6-diphenyl-4-morpholinecarboxylic Acid tert-Butyl Ester

Sign In for Pricing
View Details
Microtubule stabilizing agent-1
T79508-01 5 mg

Microtubule stabilizing agent-1

Sign In for Pricing
View Details