Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Neuronal acetylcholine receptor subunit alpha-5 (Chrna5)

This Recombinant Rat Neuronal acetylcholine receptor subunit alpha-5 (Chrna5) spans the amino acid sequence from region 28-452.

Product Specifications

Product Name Alternative

Neuronal acetylcholine receptor subunit alpha-5

UniProt

P20420

Expression Region

28-452

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AAKHEDSLFRDLFEDYERWVRPVEHLSDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQE WIDVKLRWNPDDYGGIKIIRVPSDSLWIPDIVLFDNADGRFEGASTKTVVRYNGTVTWTQ PANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDGSQVDIILEDQDVDRTDFFDNGEWEIMS AMGSKGNRTDSCCWYPYITYSFVIKRLPLFYTLFLIIPCIGLSFLTVVVFYLPSNEGEKI SLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLVFTMIFVTLSIMVTVFAINIHHRSS STHNAMAPWVRKIFLHKLPKLLCMRSHADRYFTQREEAESGAGPKSRNTLEAALDCIRYI TRHVVKENDVREVVEDWKFIAQVLDRMFLWTFLLVSIIGTLGLFVPVIYKWANIIVPVHI GNTIK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Cris-3), CF568 conjugate, 0.1mg/mL
BNC680151-500 1x 500 µL

CD11a (Cris-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF640R conjugate, 0.1mg/mL
BNC400158-100 1x 100 µL

Cytokeratin 17 (E3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL
BNC880008-100 1x 100 µL

MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL
BNC740178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL
BNC471231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (BCL2/782), CF740 conjugate, 0.1mg/mL
BNC740782-100 1x 100 µL

Bcl-2 (BCL2/782), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details