Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Neuronal acetylcholine receptor subunit alpha-5 (CHRNA5)

This Recombinant Chicken Neuronal acetylcholine receptor subunit alpha-5 (CHRNA5) spans the amino acid sequence from region 30-454.

Product Specifications

Product Name Alternative

Neuronal acetylcholine receptor subunit alpha-5

UniProt

P26152

Expression Region

30-454

Origin

Gallus gallus (Chicken)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AKSEDRLFKHLFEDYQRWVRPVEHLNDTIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEW IHVKLRWNPEDYAGITSIRVPSDSIWIPDIVLYDNADGRFEGTSTKTVVKYDGTIAWTPP VNYKSSCTIDVTFFPFDLQNCSMKFGSWTYDGSQVDIILEDYEVDKRDFFDNGEWEIVTA TGSKGNRTDGCCWYPFVTYSFIIRRLPLFYTLFLIIPCIGLSFLTVLVFYLPSNEAEKIS LCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLVFTMIFVTLSIVITVFAINIHHRSSS THNAMAPWVRKIFLHKLPKLLCMRSHVDRYFAQKEEKGNMSGSESSRNTLEAALDSIRYI TRHVMKENEVREVVEDWKFIAQVLDRMFLWAFLLVSIIGSLVLFIPVIHKWASIIVPVHI GSTNT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Cris-3), CF640R conjugate, 0.1mg/mL
BNC400151-500 1x 500 µL

CD11a (Cris-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF740 conjugate, 0.1mg/mL
BNC740008-500 1x 500 µL

MAGE A1 (MA454), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF514 conjugate, 0.1mg/mL
BNC140146-500 1x 500 µL

CD10 (CB-CALLA), CF514 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF640R conjugate, 0.1mg/mL
BNC400342-500 1x 500 µL

CD43 (84-3C1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL
BNC881050-100 1x 100 µL

CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF405S conjugate, 0.1mg/mL
BNC040633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details