Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ground squirrel hepatitis virus Large envelope protein (S)

This Recombinant Ground squirrel hepatitis virus Large envelope protein (S) spans the amino acid sequence from region 2-428.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

P03144

Expression Region

2-428

Origin

Ground squirrel hepatitis virus (strain 27) (GSHV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GNNIKVTFDPNKLAAWWPTVGTYYTPTTTVTNPAIFKPGIYQTTSLKNPKNQQELDAILM TRYKEIDWDNWQGFPVNQRLPVSNNNPPSGQRAETFEIKSRPIIVPGIRDIPRGIVPPQT PSNRDQRRKPTPLTPPLRDTHPHLTMKNQTGHLQGFAEGLRALTTSDHHNSAYGDPFTTL SPVVPTVSTTLSPPLTIGDPVLSTEMSPSGLLGLLAGLQVVYFLWTKILTIAQSLDWWWT SLSFPGGIPECTGQNLQFQTCKHLPTSCPPTCNGFRWMYLRRFIIYLLVLLLFLTFLLVL LDWKGLLPVCPMMPATETTVNCRQCTISAQDTFTTPYCCCLKPTAGNCTCWPIPSSWALG SYLWEWALARFSWLSLLVPLLQWLGGISLTVWLLLIWMIWFWGPVLMSILPPFIPIFALF FLIWAYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rpl22l1 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4610504 1.0 µg DNA

Rpl22l1 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Sssca1 (NM_001109537) Rat Tagged ORF Clone
RR210832 10 µg

Sssca1 (NM_001109537) Rat Tagged ORF Clone

Sign In for Pricing
View Details
O-GlcNAc Antibody
B2015940 50 µg

O-GlcNAc Antibody

Sign In for Pricing
View Details
Ethyl 3-chloro-2-fluoro-5-formylbenzoate
PC1016193-01 250 mg

Ethyl 3-chloro-2-fluoro-5-formylbenzoate

Sign In for Pricing
View Details
Ethyl 3-chloro-2-fluoro-5-formylbenzoate
PC1016193-02 500 mg

Ethyl 3-chloro-2-fluoro-5-formylbenzoate

Sign In for Pricing
View Details
Recombinant Porphyra yezoensis Protein cfxQ homolog (cfxQ)
MBS1442076-01 0.02 mg (E-Coli)

Recombinant Porphyra yezoensis Protein cfxQ homolog (cfxQ)

Sign In for Pricing
View Details