Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus haemolyticus Lipoteichoic acid synthase (ltaS)

This Recombinant Staphylococcus haemolyticus Lipoteichoic acid synthase (ltaS) spans the amino acid sequence from region 218-645.

Product Specifications

Product Name Alternative

Lipoteichoic acid synthase, Cleaved into the following 2 chains:, 1. Glycerol phosphate lipoteichoic acid synthase, 2. LTA synthase, EC= 3. 2.7.8.-, Polyglycerol phosphate synthase

UniProt

Q4L4D7

Expression Region

218-645

Origin

Staphylococcus haemolyticus (strain JCSC1435)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SEDDLTKVLNYTKQKNTTPNSEYFGAAKKKNIIKIHLESFQTFLINKKVNGKEVTPFLNK LSTGNEDFRYYPNFFHQTGQGKTSDAEFTMDNSLYGLPQGSAYSLKGDNTYQSLPAILDQ KQGYTSDVMHGDYKTFWNRDQVYKHFGIDKFYDATYYDMSDDNIVNLGLKDKPFFKESAE YQSKMKGPFYSHLITLTNHYPFTLSEEDADIDKPNTGDSTVDGYIQTAHYLDQALEEYVT DLKKKGLYDDSVIMIYGDHYGISENHNNAMEKLLGEKITPAKFMDLNRTGFWLKIPGKEG TVDKTYAGQMDVMPTILHLVGIDSKNFLMFGTDMLSKDHNDVIPFRNGDFITKDYKYVNG KAYSNKTNELLETQPKDLDKNKKQVEKDLEMSDNVLNGDLFRFYKNPDFKKIDPSKYEYK TGPKGNQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc25a24 ORF Vector (Mouse) (pORF)
44006014 1.0 µg DNA

Slc25a24 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Hamster Interleukin 10,IL-10 ELISA KIT
JOT-EK0027Ha-01 96 Well

Hamster Interleukin 10,IL-10 ELISA KIT

Sign In for Pricing
View Details
Hamster Interleukin 10,IL-10 ELISA KIT
JOT-EK0027Ha-02 48 Well

Hamster Interleukin 10,IL-10 ELISA KIT

Sign In for Pricing
View Details
Poly (ethylene glycol) (n) diacrylate
00669-1 1 Kg

Poly (ethylene glycol) (n) diacrylate

Sign In for Pricing
View Details
Mouse Anti Human Cd22 Monoclonal Antibody,FITC
CABT-45739MH 0.1 mg

Mouse Anti Human Cd22 Monoclonal Antibody,FITC

Sign In for Pricing
View Details
FCHO1 Rabbit Polyclonal Antibody (BF647)
orb2527439 100 µL

FCHO1 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details