Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus haemolyticus Lipoteichoic acid synthase (ltaS)

This Recombinant Staphylococcus haemolyticus Lipoteichoic acid synthase (ltaS) spans the amino acid sequence from region 218-645.

Product Specifications

Product Name Alternative

Lipoteichoic acid synthase, Cleaved into the following 2 chains:, 1. Glycerol phosphate lipoteichoic acid synthase, 2. LTA synthase, EC= 3. 2.7.8.-, Polyglycerol phosphate synthase

UniProt

Q4L4D7

Expression Region

218-645

Origin

Staphylococcus haemolyticus (strain JCSC1435)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SEDDLTKVLNYTKQKNTTPNSEYFGAAKKKNIIKIHLESFQTFLINKKVNGKEVTPFLNK LSTGNEDFRYYPNFFHQTGQGKTSDAEFTMDNSLYGLPQGSAYSLKGDNTYQSLPAILDQ KQGYTSDVMHGDYKTFWNRDQVYKHFGIDKFYDATYYDMSDDNIVNLGLKDKPFFKESAE YQSKMKGPFYSHLITLTNHYPFTLSEEDADIDKPNTGDSTVDGYIQTAHYLDQALEEYVT DLKKKGLYDDSVIMIYGDHYGISENHNNAMEKLLGEKITPAKFMDLNRTGFWLKIPGKEG TVDKTYAGQMDVMPTILHLVGIDSKNFLMFGTDMLSKDHNDVIPFRNGDFITKDYKYVNG KAYSNKTNELLETQPKDLDKNKKQVEKDLEMSDNVLNGDLFRFYKNPDFKKIDPSKYEYK TGPKGNQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ferric Chloride
B2022833 100 g

Ferric Chloride

Sign In for Pricing
View Details
SNAPAP (SNARE-associated Protein Snapin, Biogenesis of Lysosome-related Organelles Complex 1 Subunit 7, BLOC-1 Subunit 7, Synaptosomal-associated Protein 25-binding Protein, SNAP-associated Protein, BLOC1S7, SNAP25BP, SNAPIN) (MaxLight 750) discontinued
133610-ML750 100 µL

SNAPAP (SNARE-associated Protein Snapin, Biogenesis of Lysosome-related Organelles Complex 1 Subunit 7, BLOC-1 Subunit 7, Synaptosomal-associated Protein 25-binding Protein, SNAP-associated Protein, BLOC1S7, SNAP25BP, SNAPIN) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Anti-SSX2IP Rabbit Monoclonal Antibody
MA5250-.05 50 µL

Anti-SSX2IP Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
TMEM41B Human siRNA Oligo Duplex (Locus ID 440026)
SR318478 1 Kit

TMEM41B Human siRNA Oligo Duplex (Locus ID 440026)

Sign In for Pricing
View Details
GSDMB Antibody
MBS7002778-01 0.05 mg

GSDMB Antibody

Sign In for Pricing
View Details
GSDMB Antibody
MBS7002778-02 0.1 mg

GSDMB Antibody

Sign In for Pricing
View Details