Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Deinococcus radiodurans Membrane protein insertase YidC (yidC)

This Recombinant Deinococcus radiodurans Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 1-428.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

Q9RSH5

Expression Region

1-428

Origin

Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVAGRKAFALQAGDALSPDKPAEAQPAQVKTDLAANRQDAVFRYAQNGVQVTKTITLHPR NFKVDVRTEVRNGPAQVNMLFPGLGKADNPRVQAVPVGGQPASVQGSGTLSVQNIQYAAL QENPSQIAHALIVRPQQGTKVDVQLTGGPQGLVTATLPATSSLEVYGGKNELIHLYQSGY TELPGLFQPNFFGQISLLIVKLMEALYKVIGNWGLVIMALTILLRLVMWPLMQAQGRTTA RMQLVQPLQKEIQEKYKGKTDPESQRAMQMEMAQLMRDYQVNPAGCFSTLLPFPVLIALW ATIRNFEFDSGFLWLPDLATPDPFYILAVIYLFVNLGQLYVSTRKTPEMFRQQAMIYLVF LYFALTFPSGVTLYIILSTIIGIVQQIIINKQVEHETASLGQTVQKVAPGTRPASKTTVT KTIDAPKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

INPP4A Rabbit Polyclonal Antibody
TA370434 100 µL

INPP4A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD38 Recombinant Chimeric Antibody Antibody
HA601554 100 µL

CD38 Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
Zomepirac Sodium Salt Hydrate
TRC-Z675005-500MG 500 mg

Zomepirac Sodium Salt Hydrate

Sign In for Pricing
View Details
Tal1 (TAL1/3146), CF740 conjugate, 0.1mg/mL
BNC743146-500 1x 500 µL

Tal1 (TAL1/3146), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human Calnexin/CANX protein (His tag)
PDEH100903-01 20 µg

Recombinant Human Calnexin/CANX protein (His tag)

Sign In for Pricing
View Details
Recombinant Human Calnexin/CANX protein (His tag)
PDEH100903-02 100 µg

Recombinant Human Calnexin/CANX protein (His tag)

Sign In for Pricing
View Details