Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Proton extrusion protein PcxA (pcxA)

This Recombinant Synechococcus sp. Proton extrusion protein PcxA (pcxA) spans the amino acid sequence from region 1-429.

Product Specifications

Product Name Alternative

Proton extrusion protein PcxA

UniProt

B1XN58

Expression Region

1-429

Origin

Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) (Agmenellum quadruplicatum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLSTFIKKARRWFYDTPDRALEQAYRAALNIQAIELEHFGGKPVSGHNADYSDSVIRYF QGEVRKQLKIIEVRLREFRSFNTVVPVSEETIQKKASNIYYPDAADKPTLIIEKLRFIDE ITGRYGRGLSKQSVALVPLNGPEAPQTNGDRPDNKPKVETVSDKTGLVPRSIMRTFSRIQ REIDPKSNEAEAEVVTKFRRSRNKTAVSIRFLLTLVIVPLLVHQLAKIAITPFVEEHFFT EASPALFVNSDLENEAFEELEHYRATLEMRQLVGLAPALTEVEITEKIQEKATEIAQDYR AESYNAYENIFSDIFSFFAFVGILLISKREIAMLKGFLDEIVYGLSDSAKAFLIILFTDI FVGYHSPHGWEIILENVAKHFGIAESRDFNFLFIATFPVILDTVLKYWIFRYLNRISPSA VATYRNMNE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Npl sgRNA CRISPR Lentivector (Rat) (Target 2)
K6323703 1.0 µg DNA

Npl sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
RISC Double Nickase Plasmid (h)
sc-406937-NIC 20 µg

RISC Double Nickase Plasmid (h)

Sign In for Pricing
View Details
PE-Cy7 Anti-Mouse CD25 Antibody (PC-61.5.3)
PC7-30017U-01 25 µg

PE-Cy7 Anti-Mouse CD25 Antibody (PC-61.5.3)

Sign In for Pricing
View Details
PE-Cy7 Anti-Mouse CD25 Antibody (PC-61.5.3)
PC7-30017U-02 100 µg

PE-Cy7 Anti-Mouse CD25 Antibody (PC-61.5.3)

Sign In for Pricing
View Details
Rabbit anti-Oryza sativa subsp. indica (Rice) OsI_07785 Polyclonal Antibody
MBS7186413 Inquire

Rabbit anti-Oryza sativa subsp. indica (Rice) OsI_07785 Polyclonal Antibody

Sign In for Pricing
View Details
PSD4 (NM_012455) Human Tagged ORF Clone
RG209940 10 µg

PSD4 (NM_012455) Human Tagged ORF Clone

Sign In for Pricing
View Details