Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Lipoteichoic acid synthase (ltaS)

This Recombinant Staphylococcus aureus Lipoteichoic acid synthase (ltaS) spans the amino acid sequence from region 218-646.

Product Specifications

Product Name Alternative

Lipoteichoic acid synthase, Cleaved into the following 2 chains:, 1. Glycerol phosphate lipoteichoic acid synthase, 2. LTA synthase, EC= 3. 2.7.8.-, Polyglycerol phosphate synthase

UniProt

Q2G093

Expression Region

218-646

Origin

Staphylococcus aureus (strain NCTC 8325)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SEDDLTKVLNYTKQRQTEPNPEYYGVAKKKNIIKIHLESFQTFLINKKVNGKEVTPFLNK LSSGKEQFTYFPNFFHQTGQGKTSDSEFTMDNSLYGLPQGSAFSLKGDNTYQSLPAILDQ KQGYKSDVMHGDYKTFWNRDQVYKHFGIDKFYDATYYDMSDKNVVNLGLKDKIFFKDSAN YQAKMKSPFYSHLITLTNHYPFTLDEKDATIEKSNTGDATVDGYIQTARYLDEALEEYIN DLKKKGLYDNSVIMIYGDHYGISENHNNAMEKLLGEKITPAKFTDLNRTGFWIKIPGKSG GINNEYAGQVDVMPTILHLAGIDTKNYLMFGTDLFSKGHNQVVPFRNGDFITKDYKYVNG KIYSNKNNELITTQPADFEKNKKQVEKDLEMSDNVLNGDLFRFYKNPDFKKVNPSKYKYE TGPKANSKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hexanoic Acid-d5
TRC-P237773-5MG 5 mg

Hexanoic Acid-d5

Sign In for Pricing
View Details
Recombinant Human CDK5 Protein (GST Tag)
PKSH031366 50 µg

Recombinant Human CDK5 Protein (GST Tag)

Sign In for Pricing
View Details
Mouse 2610020C07Rik activation kit by CRISPRa
GA208367 1 Kit

Mouse 2610020C07Rik activation kit by CRISPRa

Sign In for Pricing
View Details
Grin1 Mouse Monoclonal Antibody [Clone ID: N308/48]
75-272 100 µL

Grin1 Mouse Monoclonal Antibody [Clone ID: N308/48]

Sign In for Pricing
View Details
QuantiChrom™ Lipase Assay Kit
DLPS-100 100 Tests

QuantiChrom™ Lipase Assay Kit

Sign In for Pricing
View Details
N-[(R)-1-Carbethoxybutyl]-(S)-alanine Benzyl Ester
TRC-C678010-50MG 50 mg

N-[(R)-1-Carbethoxybutyl]-(S)-alanine Benzyl Ester

Sign In for Pricing
View Details