Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Lipoteichoic acid synthase (ltaS)

This Recombinant Staphylococcus aureus Lipoteichoic acid synthase (ltaS) spans the amino acid sequence from region 218-646.

Product Specifications

Product Name Alternative

Lipoteichoic acid synthase, Cleaved into the following 2 chains:, 1. Glycerol phosphate lipoteichoic acid synthase, 2. LTA synthase, EC= 3. 2.7.8.-, Polyglycerol phosphate synthase

UniProt

Q2YSL2

Expression Region

218-646

Origin

Staphylococcus aureus (strain bovine RF122 / ET3-1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SEDDLTKVLNYTKQRQTEPNPEYYGVAKKKNIIKIHLESFQTFLINKKVNGKEVTPFLNK LSSGKQQFTYFPNFFHQTGQGKTSDSEFTMDNSLYGLPQGSAFSLKGDNTYQSLPAILDQ KQGYKSDVMHGDYKTFWNRDQVYKHFGIDKFYDATYYDMSDKNVVNLGLKDKIFFKDSAN YQAKMKSPFYSHLITLTNHYPFTLDEKDATIEKSNTGDATVDGYIQTARYLDEALEEYIN DLKKKGLYDNSVIMIYGDHYGISENHNNAMEKLLGEKITPAKFTDLNRTGFWIKIPGKSG GINNEYAGQVDVMPTILHLAGIDTKNYLMFGTDLFSKGHNQVVPFRNGDFITKDYKYVNG KIYSNKNNELITTQPADFEKNKKQVEKDLEMSDNVLNGDLFRFYKNPDFKKVNPSKYKYE TGPKANSKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKC epsilon (PRKCE) Rabbit Polyclonal Antibody
AP20353PU-N 100 µg

PKC epsilon (PRKCE) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ibuprofen 2-Monoglyceride
TRC-I400140-250MG 250 mg

Ibuprofen 2-Monoglyceride

Sign In for Pricing
View Details
Rat Defensin Beta 1 (DEFb1) ELISA Kit
RDR-DEFb1-Ra-01 96 Tests

Rat Defensin Beta 1 (DEFb1) ELISA Kit

Sign In for Pricing
View Details
Rat Defensin Beta 1 (DEFb1) ELISA Kit
RDR-DEFb1-Ra-02 48 Tests

Rat Defensin Beta 1 (DEFb1) ELISA Kit

Sign In for Pricing
View Details
Cdc45 Mouse Gene Knockout Kit (CRISPR)
KN502984 1 Kit

Cdc45 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
VEGF-A (VEGF/1063), Biotin conjugate, 0.1mg/mL
BNCB1063-500 1x 500 µL

VEGF-A (VEGF/1063), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details