Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Lipoteichoic acid synthase (ltaS)

This Recombinant Staphylococcus saprophyticus subsp. saprophyticus Lipoteichoic acid synthase (ltaS) spans the amino acid sequence from region 218-646.

Product Specifications

Product Name Alternative

Lipoteichoic acid synthase, Cleaved into the following 2 chains:, 1. Glycerol phosphate lipoteichoic acid synthase, 2. LTA synthase, EC= 3. 2.7.8.-, Polyglycerol phosphate synthase

UniProt

Q49VR4

Expression Region

218-646

Origin

Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

NEDDLTKVLNYTKQKQTEPNKEYFGAAKKKNIIKIHLESFQTFLINKKVNGEEVTPFLNK LSTGNEGYRYYPNFYHQTGQGKTSDSEFTMDNSLFGLPQGSAYSLKGDNTYQSLPAILDQ QQGYTSSVMHGDYKTFWNRDQVYKHFGIDKFYDATYYDMSEDNIENLGLKDKEFFKESAD YLAKEKQPFYNHLITLTNHYPFTVSPEDASIEKPNTGDSTVDGYIQTARYLDESLEEFVN ELKKKGLYDDSVIMIYGDHYGISENHNKAMEKLLGEDITPAKFNDLNRTGFWLKIPGKEG TVDKTYAGQADVMPTILHLMGIDTKNYLMMGTDLLSKDHNDTVPFRNGDFVTKDYKYVNG RIYDNKNNEPMTEKPKDFEKRKQQSEKDLQMSDDVLNGDLLRFYDNPDFDKIKPSEYEYK TGPKGQERK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human insulin receptor β (ISR-β) ELISA Kit
YP-W14244-01 48 Tests

Human insulin receptor β (ISR-β) ELISA Kit

Sign In for Pricing
View Details
Human insulin receptor β (ISR-β) ELISA Kit
YP-W14244-02 96 Tests

Human insulin receptor β (ISR-β) ELISA Kit

Sign In for Pricing
View Details
Human Cardiac Troponin I Recombinant Protein
PROTP19429-10ug 10 µg

Human Cardiac Troponin I Recombinant Protein

Sign In for Pricing
View Details
Mouse Tigd2 Pre-designed siRNA Set B
SI114604B 1 Each

Mouse Tigd2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
PRKACA (Protein Kinase, cAMP-Dependent, Catalytic, alpha, MGC102831, MGC48865, PKACA) (HRP)
250463-HRP 100 µL

PRKACA (Protein Kinase, cAMP-Dependent, Catalytic, alpha, MGC102831, MGC48865, PKACA) (HRP)

Sign In for Pricing
View Details
Sct Mouse Gene Knockout Kit (CRISPR)
KN515408 1 Kit

Sct Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details