Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Lipoteichoic acid synthase (ltaS)

This Recombinant Staphylococcus aureus Lipoteichoic acid synthase (ltaS) spans the amino acid sequence from region 218-646.

Product Specifications

Product Name Alternative

Lipoteichoic acid synthase, Cleaved into the following 2 chains:, 1. Glycerol phosphate lipoteichoic acid synthase, 2. LTA synthase, EC= 3. 2.7.8.-, Polyglycerol phosphate synthase

UniProt

Q6GBB1

Expression Region

218-646

Origin

Staphylococcus aureus (strain MSSA476)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SEDDLTKVLNYTKQRQTEPNPEYYGVAKKKNIIKIHLESFQTFLINKKVNGKEVTPFLNK LSSGKEQFTYFPNFFHQTGQGKTSDSEFTMDNSLYGLPQGSAFSLKGDNTYQSLPAILDQ KQGYKSDVMHGDYKTFWNRDQVYKHFGIDKFYDATYYDMSDKNVVNLGLKDKIFFKDSAN YQAKMKSPFYSHLITLTNHYPFTLDEKDATIEKSNTGDATVDGYIQTARYLDEALEEYIN DLKKKGLYDNSVIMIYGDHYGISENHNNAMEKLLGEKITPAKFTDLNRTGFWIKIPGKSG GINNEYAGQVDVMPTILHLAGIDTKNYLMFGTDLFSKGHNQVVPFRNGDFITKDYKYVNG KIYSNKNNELITTQPADFEKNKKQVEKDLEMSDNVLNGDLFRFYKNPDFKKVNPSKYKYE TGPKANSKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD32a/FCGR2A Protein (167 Arg, His&AVI Tag), Biotinylated
PKSH030292-01 20 µg

Recombinant Human CD32a/FCGR2A Protein (167 Arg, His&AVI Tag), Biotinylated

Sign In for Pricing
View Details
Recombinant Human CD32a/FCGR2A Protein (167 Arg, His&AVI Tag), Biotinylated
PKSH030292-02 100 µg

Recombinant Human CD32a/FCGR2A Protein (167 Arg, His&AVI Tag), Biotinylated

Sign In for Pricing
View Details
FLT3 Human Gene Knockout Kit (CRISPR)
KN211459BN 1 Kit

FLT3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MDM2 (Ab-186/188) Antibody
8B1154-AAT 50 µg

MDM2 (Ab-186/188) Antibody

Sign In for Pricing
View Details
MM 2-10 [N- (3-Triethylammoniumpropyl) -4- (4- (diethylamino) styryl) pyridinium dibromide]
21489-AAT 1 mg

MM 2-10 [N- (3-Triethylammoniumpropyl) -4- (4- (diethylamino) styryl) pyridinium dibromide]

Sign In for Pricing
View Details
Mouse S100 Calcium Binding Protein A11 (S100A11) ELISA Kit
RDR-S100A11-Mu-01 96 Tests

Mouse S100 Calcium Binding Protein A11 (S100A11) ELISA Kit

Sign In for Pricing
View Details