Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Lipoteichoic acid synthase (ltaS)

This Recombinant Staphylococcus aureus Lipoteichoic acid synthase (ltaS) spans the amino acid sequence from region 218-646.

Product Specifications

Product Name Alternative

Lipoteichoic acid synthase, Cleaved into the following 2 chains:, 1. Glycerol phosphate lipoteichoic acid synthase, 2. LTA synthase, EC= 3. 2.7.8.-, Polyglycerol phosphate synthase

UniProt

Q6GBB1

Expression Region

218-646

Origin

Staphylococcus aureus (strain MSSA476)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SEDDLTKVLNYTKQRQTEPNPEYYGVAKKKNIIKIHLESFQTFLINKKVNGKEVTPFLNK LSSGKEQFTYFPNFFHQTGQGKTSDSEFTMDNSLYGLPQGSAFSLKGDNTYQSLPAILDQ KQGYKSDVMHGDYKTFWNRDQVYKHFGIDKFYDATYYDMSDKNVVNLGLKDKIFFKDSAN YQAKMKSPFYSHLITLTNHYPFTLDEKDATIEKSNTGDATVDGYIQTARYLDEALEEYIN DLKKKGLYDNSVIMIYGDHYGISENHNNAMEKLLGEKITPAKFTDLNRTGFWIKIPGKSG GINNEYAGQVDVMPTILHLAGIDTKNYLMFGTDLFSKGHNQVVPFRNGDFITKDYKYVNG KIYSNKNNELITTQPADFEKNKKQVEKDLEMSDNVLNGDLFRFYKNPDFKKVNPSKYKYE TGPKANSKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRIK5 Rabbit Polyclonal Antibody
TA372691 100 µL

GRIK5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B1), Biotin conjugate, 0.1mg/mL
BNCB1930-100 1x 100 µL

PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NMDAR1 (GRIN1) (NM_000832) Human Recombinant Protein
TP319368M 100 µg

NMDAR1 (GRIN1) (NM_000832) Human Recombinant Protein

Sign In for Pricing
View Details
TNIP2 Polyclonal Antibody
E-AB-13747-01 20 µL

TNIP2 Polyclonal Antibody

Sign In for Pricing
View Details
TNIP2 Polyclonal Antibody
E-AB-13747-02 60 µL

TNIP2 Polyclonal Antibody

Sign In for Pricing
View Details
TNIP2 Polyclonal Antibody
E-AB-13747-03 120 µL

TNIP2 Polyclonal Antibody

Sign In for Pricing
View Details