Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Lipoteichoic acid synthase (ltaS)

This Recombinant Staphylococcus aureus Lipoteichoic acid synthase (ltaS) spans the amino acid sequence from region 218-646.

Product Specifications

Product Name Alternative

Lipoteichoic acid synthase, Cleaved into the following 2 chains:, 1. Glycerol phosphate lipoteichoic acid synthase, 2. LTA synthase, EC= 3. 2.7.8.-, Polyglycerol phosphate synthase

UniProt

Q6GBB1

Expression Region

218-646

Origin

Staphylococcus aureus (strain MSSA476)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SEDDLTKVLNYTKQRQTEPNPEYYGVAKKKNIIKIHLESFQTFLINKKVNGKEVTPFLNK LSSGKEQFTYFPNFFHQTGQGKTSDSEFTMDNSLYGLPQGSAFSLKGDNTYQSLPAILDQ KQGYKSDVMHGDYKTFWNRDQVYKHFGIDKFYDATYYDMSDKNVVNLGLKDKIFFKDSAN YQAKMKSPFYSHLITLTNHYPFTLDEKDATIEKSNTGDATVDGYIQTARYLDEALEEYIN DLKKKGLYDNSVIMIYGDHYGISENHNNAMEKLLGEKITPAKFTDLNRTGFWIKIPGKSG GINNEYAGQVDVMPTILHLAGIDTKNYLMFGTDLFSKGHNQVVPFRNGDFITKDYKYVNG KIYSNKNNELITTQPADFEKNKKQVEKDLEMSDNVLNGDLFRFYKNPDFKKVNPSKYKYE TGPKANSKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat EGF Protein
PKSR030544-01 100 µg

Recombinant Rat EGF Protein

Sign In for Pricing
View Details
Recombinant Rat EGF Protein
PKSR030544-02 1 mg

Recombinant Rat EGF Protein

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Helix aspersa Lectin (Garden Snail) -HAA-
LA-3801-1 1 mg

Alkaline Phosphatase Conjugated Helix aspersa Lectin (Garden Snail) -HAA-

Sign In for Pricing
View Details
FGF9 (N-term) Rabbit Polyclonal Antibody
AP51661PU-N 400 µL

FGF9 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GABA A Receptor alpha 1 (GABRA1) (NM_000806) Human Over-expression Lysate
LY400282 100 µg

GABA A Receptor alpha 1 (GABRA1) (NM_000806) Human Over-expression Lysate

Sign In for Pricing
View Details
RBM12B Antibody
KC-42010-01 50 μL

RBM12B Antibody

Sign In for Pricing
View Details