Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Lipoteichoic acid synthase (ltaS)

This Recombinant Staphylococcus aureus Lipoteichoic acid synthase (ltaS) spans the amino acid sequence from region 218-646.

Product Specifications

Product Name Alternative

Lipoteichoic acid synthase, Cleaved into the following 2 chains:, 1. Glycerol phosphate lipoteichoic acid synthase, 2. LTA synthase, EC= 3. 2.7.8.-, Polyglycerol phosphate synthase

UniProt

Q7A1I3

Expression Region

218-646

Origin

Staphylococcus aureus (strain MW2)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SEDDLTKVLNYTKQRQTEPNPEYYGVAKKKNIIKIHLESFQTFLINKKVNGKEVTPFLNK LSSGKEQFTYFPNFFHQTGQGKTSDSEFTMDNSLYGLPQGSAFSLKGDNTYQSLPAILDQ KQGYKSDVMHGDYKTFWNRDQVYKHFGIDKFYDATYYDMSDKNVVNLGLKDKIFFKDSAN YQAKMKSPFYSHLITLTNHYPFTLDEKDATIEKSNTGDATVDGYIQTARYLDEALEEYIN DLKKKGLYDNSVIMIYGDHYGISENHNNAMEKLLGEKITPAKFTDLNRTGFWIKIPGKSG GINNEYAGQVDVMPTILHLAGIDTKNYLMFGTDLFSKGHNQVVPFRNGDFITKDYKYVNG KIYSNKNNELITTQPADFEKNKKQVEKDLEMSDNVLNGDLFRFYKNPDFKKVNPSKYKYE TGPKANSKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2- (2,4-Dichlorophenoxy) propanoic acid
CS-M-13872 1 Each

2- (2,4-Dichlorophenoxy) propanoic acid

Sign In for Pricing
View Details
Troponin I, Fast Skeletal, Recombinant, Human (fsTnI)
MBS636502-01 0.005 mg

Troponin I, Fast Skeletal, Recombinant, Human (fsTnI)

Sign In for Pricing
View Details
Troponin I, Fast Skeletal, Recombinant, Human (fsTnI)
MBS636502-02 0.02 mg

Troponin I, Fast Skeletal, Recombinant, Human (fsTnI)

Sign In for Pricing
View Details
Troponin I, Fast Skeletal, Recombinant, Human (fsTnI)
MBS636502-03 5x 0.02 mg

Troponin I, Fast Skeletal, Recombinant, Human (fsTnI)

Sign In for Pricing
View Details
Human IL2Ra ELISA Kit
orb437300 96 Tests

Human IL2Ra ELISA Kit

Sign In for Pricing
View Details
SCAF11 Peptide
DF15740-BP 1 mg

SCAF11 Peptide

Sign In for Pricing
View Details