Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Lipoteichoic acid synthase (ltaS)

This Recombinant Staphylococcus epidermidis Lipoteichoic acid synthase (ltaS) spans the amino acid sequence from region 218-646.

Product Specifications

Product Name Alternative

Lipoteichoic acid synthase, Cleaved into the following 2 chains:, 1. Glycerol phosphate lipoteichoic acid synthase, 2. LTA synthase, EC= 3. 2.7.8.-, Polyglycerol phosphate synthase

UniProt

Q8CQ10

Expression Region

218-646

Origin

Staphylococcus epidermidis (strain ATCC 12228)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SEDDLTKVLNYTKQKRTEPNPEYYGAAKKKNIIKIHLESFQTFLINKKVNGKEVTPFLNK LSSGNQDFTYFPNFFHQTGQGKTSDSEFTMDNSLYGLPQGSAYSLKGDNTYQSLPAILDQ KQGYTSNVMHGDYKTFWNRDQVYKHFGIDNFYDATYYDMSDDNIVNLGLKDKPFFKASAD YQSKMKKPFYSHLITLTNHYPFTLDEEDASIDKPNTGDSTVDGYIQTAHYLDQALEEYIT DLKKKGLYDNSVIMIYGDHYGISENHNNAMEKLLGEKITPAKFTDLNRTGFWLKVPGKSG GVNKEYAGQMDVMPTLLHLVGIDSKNYLMFGSDMFSKQHNNVVPFRNGDFITEDYKYVNG KIYSNKDNELLTEKPKDFDKNKKQVEKDLEMSDSVLNGDLFRFYKNPDFKKVNPGKYEYK SGPKGNEKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PROSC Protein Vector (Mouse) (pPB-N-His)
PV219695 500 ng

PROSC Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Der F1 Mosaic Protein Recombinant
rAP-2763 1 Each

Der F1 Mosaic Protein Recombinant

Sign In for Pricing
View Details
IVD Human qPCR Template Standard (NM_002225)
HK209071 1 Kit

IVD Human qPCR Template Standard (NM_002225)

Sign In for Pricing
View Details
MEM Alpha Medium Powder
50-012-PC 1 Each

MEM Alpha Medium Powder

Sign In for Pricing
View Details
Human N-Acetylneuraminic Acid Synthase (NANS) ELISA Kit
MBS453129-01 48 Tests

Human N-Acetylneuraminic Acid Synthase (NANS) ELISA Kit

Sign In for Pricing
View Details
Human N-Acetylneuraminic Acid Synthase (NANS) ELISA Kit
MBS453129-02 96 Tests

Human N-Acetylneuraminic Acid Synthase (NANS) ELISA Kit

Sign In for Pricing
View Details