Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Woodchuck hepatitis B virus Large envelope protein (S)

This Recombinant Woodchuck hepatitis B virus Large envelope protein (S) spans the amino acid sequence from region 2-431.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

P06432

Expression Region

2-431

Origin

Woodchuck hepatitis B virus (isolate 2) (WHV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GNNIKVTFNPDKIAAWWPAVGTYYTTTYPQNQSVFQPGIYQTTSLINPKNQQELDSVLIN RYKQIDWNTWQGFPVDQKFSLVSRDPPPKPYINQSAQTFEIKPGPIIVPGIRDIPRGLVP PQTPTNRDQGRKPTPPTPPLRDTHPHLTMKNQTFHLQGFVDGLRDLTTTERQHNAYRDPF TTLSPAVPTVSTILSPPSTTGDPALSPEMSPSSLLGLLAGLQVVYFLWTKILTIAQNLDW WCTSLSFPGGIPECTGQNSQFQTCKHLPTSCPPTCNGFRWMYLRRFIIYLLVLLLCLIFL LVLLDWKGLIPVCPLQPTTETTVNCRQCTISAQDMYTPPYCCCLKPTAGNCTCWPIPSSW ALGNYLWEWALARLSWLNLLVPLLQWLGGISLIAWFLLIWMIWFWGPALLSILPPFIPIF VLFFLIWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (RIV11), CF488A conjugate, 0.1mg/mL
BNC880333-500 1x 500 µL

CD8 (RIV11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL
BNC880008-100 1x 100 µL

MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF770 conjugate, 0.1mg/mL
BNC700164-100 1x 100 µL

CD28 (204.12), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF640R conjugate, 0.1mg/mL
BNC400270-100 1x 100 µL

Fibronectin (HFN7.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF740 conjugate, 0.1mg/mL
BNC741429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF770 conjugate, 0.1mg/mL
BNC700164-500 1x 500 µL

CD28 (204.12), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details