Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human RING finger protein 26 (RNF26)

This Recombinant Human RING finger protein 26 (RNF26) spans the amino acid sequence from region 1-433.

Product Specifications

Product Name Alternative

RING finger protein 26

UniProt

Q9BY78

Expression Region

1-433

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEAVYLVVNGLGLVLDVLTLVLDLNFLLVSSLLASLAWLLAFVYNLPHTVLTSLLHLGRG VLLSLLALIEAVVRFTCGGLQALCTLLYSCCSGLESLKLLGHLASHGALRSREILHRGVL NVVSSGHALLRQACDICAIAMSLVAYVINSLVNICLIGTQNLFSLVLALWDAVTGPLWRM TDVVAAFLAHISSSAVAMAILLWTPCQLALELLASAARLLASFVLVNLTGLVLLACVLAV TVTVLHPDFTLRLATQALSQLHARPSYHRLREDVMRLSRLALGSEAWRRVWSRSLQLASW PNRGGAPGAPQGDPMRVFSVRTRRQDTLPEAGRRSEAEEEEARTIRVTPVRGRERLNEEE PPGGQDPWKLLKEQEERKKCVICQDQSKTVLLLPCRHLCLCQACTEILMRHPVYHRNCPL CRRGILQTLNVYL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NXF1 Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-61943R-BF555-01 20 µL

NXF1 Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
NXF1 Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-61943R-BF555-02 100 µL

NXF1 Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal OFD1 Antibody [Alexa Fluor 700]
NBP2-99227AF700 0.1 mL

Rabbit Polyclonal OFD1 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
Atractylenolide III
S9313-1mg 1 mg

Atractylenolide III

Sign In for Pricing
View Details
Rabbit Polyclonal PDCL Antibody [mFluor Violet 500 SE]
NBP2-81862MFV500 0.1 mL

Rabbit Polyclonal PDCL Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details
ER81 Rabbit pAb
E47R11745 100 µL

ER81 Rabbit pAb

Sign In for Pricing
View Details