Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Innexin-14 (inx-14)

This Recombinant Innexin-14 (inx-14) spans the amino acid sequence from region 1-434.

Product Specifications

Product Name Alternative

Innexin-14, Protein opu-14

UniProt

O62136

Expression Region

1-434

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIWEIPIIGDFITKPFKAAKLYEFYDRLHLFTVYLLGFFVLLTGAKQHFGNPIDCMLPKQ HDDLKSWRDYIHNFCLFYGTFRYDVSNGTSEFGSYTEDASVNYYQWVPFFFAFQVCCFLL PFWCWAYMQKLIYIDMAFIVDYSGKINSEKTFEKTKEKVDRIVNYMHDHFKFRRAHKMGY LSWITFNSAFPSVLYSLTKLFFITNVIIQVNLVCKFLDVDSWTWGFDLLGKFIHPTPRAP EFSSFSDKQRFAAILTDGSYNRFQYFPILVGCEYQLQESVSNFVNHKAQCIIPMNVINEK IFIGLYFWLLVLTALSVIGTVKWILRIKSKKLNEVMIYKLIKKSLEREPFDSNIHDHRYN FVHKYLCADGILLIYFMMDTNGFLKTEEVIGALFKKYCSDAGLEPLQTAPTLTSSPRDLA YSETNYGFAAPQKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP26 Rabbit Monoclonal Antibody [Clone ID: R01-7A4]
TA422115 100 µL

MMP26 Rabbit Monoclonal Antibody [Clone ID: R01-7A4]

Sign In for Pricing
View Details
Human Ubiquitin Protein Ligase E3A (UBE3A) ELISA Kit
RD-UBE3A-Hu-01 96 Tests

Human Ubiquitin Protein Ligase E3A (UBE3A) ELISA Kit

Sign In for Pricing
View Details
Human Ubiquitin Protein Ligase E3A (UBE3A) ELISA Kit
RD-UBE3A-Hu-02 48 Tests

Human Ubiquitin Protein Ligase E3A (UBE3A) ELISA Kit

Sign In for Pricing
View Details
IGF1 Receptor (IGF1R) pTyr1161 Rabbit Polyclonal Antibody
AP01610PU-N 100 µg

IGF1 Receptor (IGF1R) pTyr1161 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Procollagen Lysine-2-Oxoglutarate-5-Dioxygenase 2 (PLOD2) ELISA Kit
RD-PLOD2-Hu-01 96 Tests

Human Procollagen Lysine-2-Oxoglutarate-5-Dioxygenase 2 (PLOD2) ELISA Kit

Sign In for Pricing
View Details
Human Procollagen Lysine-2-Oxoglutarate-5-Dioxygenase 2 (PLOD2) ELISA Kit
RD-PLOD2-Hu-02 48 Tests

Human Procollagen Lysine-2-Oxoglutarate-5-Dioxygenase 2 (PLOD2) ELISA Kit

Sign In for Pricing
View Details