Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Semliki forest virus Structural polyprotein

This Recombinant Semliki forest virus Structural polyprotein spans the amino acid sequence from region 816-1253.

Product Specifications

Product Name Alternative

Structural polyprotein, p130, Cleaved into the following 6 chains:, 1. Capsid protein, EC= 2. 3.4.21.90, Coat protein, C, p62, E3/E2

UniProt

P03315

Expression Region

816-1253

Origin

Semliki forest virus (SFV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YEHSTVMPNVVGFPYKAHIERPGYSPLTLQMQVVETSLEPTLNLEYITCEYKTVVPSPYV KCCGASECSTKEKPDYQCKVYTGVYPFMWGGAYCFCDSENTQLSEAYVDRSDVCRHDHAS AYKAHTASLKAKVRVMYGNVNQTVDVYVNGDHAVTIGGTQFIFGPLSSAWTPFDNKIVVY KDEVFNQDFPPYGSGQPGRFGDIQSRTVESNDLYANTALKLARPSPGMVHVPYTQTPSGF KYWLKEKGTALNTKAPFGCQIKTNPVRAMNCAVGNIPVSMNLPDSAFTRIVEAPTIIDLT CTVATCTHSSDFGGVLTLTYKTNKNGDCSVHSHSNVATLQEATAKVKTAGKVTLHFSTAS ASPSFVVSLCSARATCSASCEPPKDHIVPYAASHSNVVFPDMSGTALSWVQKISGGLGAF AIGAILVLVVVTCIGLRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Staphylococcus aureus UPF0354 protein SAOUHSC_01859 (SAOUHSC_01859)
MBS1469209-01 0.02 mg (E-Coli)

Recombinant Staphylococcus aureus UPF0354 protein SAOUHSC_01859 (SAOUHSC_01859)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus UPF0354 protein SAOUHSC_01859 (SAOUHSC_01859)
MBS1469209-02 0.02 mg (Yeast)

Recombinant Staphylococcus aureus UPF0354 protein SAOUHSC_01859 (SAOUHSC_01859)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus UPF0354 protein SAOUHSC_01859 (SAOUHSC_01859)
MBS1469209-03 0.1 mg (E-Coli)

Recombinant Staphylococcus aureus UPF0354 protein SAOUHSC_01859 (SAOUHSC_01859)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus UPF0354 protein SAOUHSC_01859 (SAOUHSC_01859)
MBS1469209-04 0.1 mg (Yeast)

Recombinant Staphylococcus aureus UPF0354 protein SAOUHSC_01859 (SAOUHSC_01859)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus UPF0354 protein SAOUHSC_01859 (SAOUHSC_01859)
MBS1469209-05 0.02 mg (Baculovirus)

Recombinant Staphylococcus aureus UPF0354 protein SAOUHSC_01859 (SAOUHSC_01859)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus UPF0354 protein SAOUHSC_01859 (SAOUHSC_01859)
MBS1469209-06 0.02 mg (Mammalian-Cell)

Recombinant Staphylococcus aureus UPF0354 protein SAOUHSC_01859 (SAOUHSC_01859)

Sign In for Pricing
View Details