Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aura virus Structural polyprotein

This Recombinant Aura virus Structural polyprotein spans the amino acid sequence from region 807-1244.

Product Specifications

Product Name Alternative

Structural polyprotein, p130, Cleaved into the following 6 chains:, 1. Capsid protein, EC= 2. 3.4.21.90, Coat protein, C, p62, E3/E2

UniProt

Q86925

Expression Region

807-1244

Origin

Aura virus (AURAV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YEHTITVPNAPLNSYKALVERPGYAPLNLEVMVMNTQIIPSVKREYITCRYHTVVPSPQI KCCGTVECPKGEKADYTCKVFTGVYPFLWGGAQCFCDSENSQLSDKYVELSTDCATDHAE AVRVHTASVKSQLRITYGNSTAQVDVFVNGVTPARSKDMKLIAGPLSTTFSPFDNKVIIY HGKVYNYDFPEFGAGTPGAFGDVQASSTTGSDLLANTAIHLQRPEARNIHVPYTQAPSGF EFWKNNSGQPLSDTAPFGCKVNVNPLRADKCAVGSLPISVDIPDAAFTRVSEPLPSLLKC TVTSCTYSTDYGGVLVLTYESDRAGQCAVHSHSSTAVLRDPSVYVEQKGETTLKFSTRSL QADFEVSMCGTRTTCHAQCQPPTEHVMNRPQKSTPDFSSAISKTSWNWITALMGGISSIA AIAAIVLVIALVFTAQHR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Iqca1 Pre-designed siRNA Set B
SI206828B 1 Each

Rat Iqca1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
PYDC1 Peptide - N-terminal region
orb2003005 100 µg

PYDC1 Peptide - N-terminal region

Sign In for Pricing
View Details
Platelet-derived Growth Factor D, ID (SCDGFB, PDGF-D, Iris-expressed Growth Factor, Spinal Cord-derived Growth Factor B, SCDGF-B, Pdgfd, Iegf) (AP) discontinued
P4258-98-AP 200 µL

Platelet-derived Growth Factor D, ID (SCDGFB, PDGF-D, Iris-expressed Growth Factor, Spinal Cord-derived Growth Factor B, SCDGF-B, Pdgfd, Iegf) (AP) discontinued

Sign In for Pricing
View Details
Porcine sCD14 (Soluble Cluster of Differentiation14) ELISA Kit
MBS2505397-01 24 Tests (Limit 1)

Porcine sCD14 (Soluble Cluster of Differentiation14) ELISA Kit

Sign In for Pricing
View Details
Porcine sCD14 (Soluble Cluster of Differentiation14) ELISA Kit
MBS2505397-02 48 Tests

Porcine sCD14 (Soluble Cluster of Differentiation14) ELISA Kit

Sign In for Pricing
View Details
Porcine sCD14 (Soluble Cluster of Differentiation14) ELISA Kit
MBS2505397-03 96 Tests

Porcine sCD14 (Soluble Cluster of Differentiation14) ELISA Kit

Sign In for Pricing
View Details