Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aura virus Structural polyprotein

This Recombinant Aura virus Structural polyprotein spans the amino acid sequence from region 807-1244.

Product Specifications

Product Name Alternative

Structural polyprotein, p130, Cleaved into the following 6 chains:, 1. Capsid protein, EC= 2. 3.4.21.90, Coat protein, C, p62, E3/E2

UniProt

Q86925

Expression Region

807-1244

Origin

Aura virus (AURAV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YEHTITVPNAPLNSYKALVERPGYAPLNLEVMVMNTQIIPSVKREYITCRYHTVVPSPQI KCCGTVECPKGEKADYTCKVFTGVYPFLWGGAQCFCDSENSQLSDKYVELSTDCATDHAE AVRVHTASVKSQLRITYGNSTAQVDVFVNGVTPARSKDMKLIAGPLSTTFSPFDNKVIIY HGKVYNYDFPEFGAGTPGAFGDVQASSTTGSDLLANTAIHLQRPEARNIHVPYTQAPSGF EFWKNNSGQPLSDTAPFGCKVNVNPLRADKCAVGSLPISVDIPDAAFTRVSEPLPSLLKC TVTSCTYSTDYGGVLVLTYESDRAGQCAVHSHSSTAVLRDPSVYVEQKGETTLKFSTRSL QADFEVSMCGTRTTCHAQCQPPTEHVMNRPQKSTPDFSSAISKTSWNWITALMGGISSIA AIAAIVLVIALVFTAQHR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Staphylococcus aureus UPF0478 protein SAS1665 (SAS1665), partial
MBS1468134-01 0.5 mg (E-Coli)

Recombinant Staphylococcus aureus UPF0478 protein SAS1665 (SAS1665), partial

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus UPF0478 protein SAS1665 (SAS1665), partial
MBS1468134-02 0.05 mg (Baculovirus)

Recombinant Staphylococcus aureus UPF0478 protein SAS1665 (SAS1665), partial

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus UPF0478 protein SAS1665 (SAS1665), partial
MBS1468134-03 0.5 mg (Yeast)

Recombinant Staphylococcus aureus UPF0478 protein SAS1665 (SAS1665), partial

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus UPF0478 protein SAS1665 (SAS1665), partial
MBS1468134-04 0.05 mg (Mammalian-Cell)

Recombinant Staphylococcus aureus UPF0478 protein SAS1665 (SAS1665), partial

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus UPF0478 protein SAS1665 (SAS1665), partial
MBS1468134-05 1 mg (E-Coli)

Recombinant Staphylococcus aureus UPF0478 protein SAS1665 (SAS1665), partial

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus UPF0478 protein SAS1665 (SAS1665), partial
MBS1468134-06 0.1 mg (Baculovirus)

Recombinant Staphylococcus aureus UPF0478 protein SAS1665 (SAS1665), partial

Sign In for Pricing
View Details