Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chikungunya virus Structural polyprotein

This Recombinant Chikungunya virus Structural polyprotein spans the amino acid sequence from region 810-1248.

Product Specifications

Product Name Alternative

Structural polyprotein, p130, Cleaved into the following 6 chains:, 1. Capsid protein, EC= 2. 3.4.21.90, Coat protein, C, p62, E3/E2

UniProt

Q5XXP3

Expression Region

810-1248

Origin

Chikungunya virus (strain 37997) (CHIKV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YEHVTVIPNTVGVPYKTLVNRPGYSPMVLEMELQSVTLEPTLSLDYITCEYKTVIPSPYV KCCGTAECKDKSLPDYSCKVFTGVYPFMWGGAYCFCDAENTQLSEAHVEKSESCKTEFAS AYRAHTASASAKLRVLYQGNNITVAAYANGDHAVTVKDAKFVVGPMSSAWTPFDNKIVVY KGDVYNMDYPPFGAGRPGQFGDIQSRTPESKDVYANTQLVLQRPAAGTVHVPYSQAPSGF KYWLKERGASLQHTAPFGCQIATNPVRAVNCAVGNIPISIDIPDAAFTRVVDAPSVTDMS CEVPACTHSSDFGGVAIIKYTASKKGKCAVHSMTNAVTIREADVEVEGNSQLQISFSTAL ASAEFRVQVCSTQVHCAAACHPPKDHIVNYPASHTTLGVQDISTTAMSWVQKITGGVGLI VAVAALILIVVLCVSFSRH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

P100601_T100 - CTNNB1 antibody - C-terminal region (P100601_T100)
P100601_T100 100 µL

P100601_T100 - CTNNB1 antibody - C-terminal region (P100601_T100)

Sign In for Pricing
View Details
PSMB8, NT (PSMB8, LMP7, PSMB5i, RING10, Y2, Proteasome subunit beta type-8, Low molecular mass protein 7, Macropain subunit C13, Multicatalytic endopeptidase complex subunit C13, Proteasome component C13, Proteasome subunit beta-5i, Really interesting new gene 10 protein) (PE) discontinued
040559-PE 200 µL

PSMB8, NT (PSMB8, LMP7, PSMB5i, RING10, Y2, Proteasome subunit beta type-8, Low molecular mass protein 7, Macropain subunit C13, Multicatalytic endopeptidase complex subunit C13, Proteasome component C13, Proteasome subunit beta-5i, Really interesting new gene 10 protein) (PE) discontinued

Sign In for Pricing
View Details
Recombinant Xylella fastidiosa Bis (5'-nucleosyl) -tetraphosphatase, symmetrical
MBS1210109-01 0.02 mg (E-Coli)

Recombinant Xylella fastidiosa Bis (5'-nucleosyl) -tetraphosphatase, symmetrical

Sign In for Pricing
View Details
Recombinant Xylella fastidiosa Bis (5'-nucleosyl) -tetraphosphatase, symmetrical
MBS1210109-02 0.1 mg (E-Coli)

Recombinant Xylella fastidiosa Bis (5'-nucleosyl) -tetraphosphatase, symmetrical

Sign In for Pricing
View Details
Recombinant Xylella fastidiosa Bis (5'-nucleosyl) -tetraphosphatase, symmetrical
MBS1210109-03 0.02 mg (Baculovirus)

Recombinant Xylella fastidiosa Bis (5'-nucleosyl) -tetraphosphatase, symmetrical

Sign In for Pricing
View Details
Recombinant Xylella fastidiosa Bis (5'-nucleosyl) -tetraphosphatase, symmetrical
MBS1210109-04 0.02 mg (Mammalian-Cell)

Recombinant Xylella fastidiosa Bis (5'-nucleosyl) -tetraphosphatase, symmetrical

Sign In for Pricing
View Details