Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bordetella pertussis Type IV secretion system protein ptlD (ptlD)

This Recombinant Bordetella pertussis Type IV secretion system protein ptlD (ptlD) spans the amino acid sequence from region 25-463.

Product Specifications

Product Name Alternative

Type IV secretion system protein ptlD, Pertussis toxin liberation protein D

UniProt

Q7VSX8

Expression Region

25-463

Origin

Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SVDDPTRAGGDNRVRALRADQARRDVLLTACRDDPGHRRGEPDCVNAERAQALQQWQAAA MTSVDAAFSDLAGALRNAAPRRMEAAIVRLTRQLQPLVYSMMTLLVLLTGYALLARRDRP FEWHIRHALLVAVVTSLALSPDRYLSTVVAGVQDVAGWLSGPWTAPDGAAGRGGLAQLDQ FAAQAQAWVAQLAGQAANDANPGSAVNWLLCAMIVAASAGGWLCLAASLLIVPGLIVTLL LSLGPLFLVLLLFPALQRWTNAWLGALVRALVFMALGTPAVGLLSDVLAGALPAGLPQRF ATDPLRSTMLAATLCATATLMLLTLVPLASSVNAGLRRRLWPNAAHPGLAQAHRQAAARQ YAPRPAAAAAAAGPHQAGTYAASATPAPAPARPAPSFPAHAYRQYALGGARRPPPRVRRD DRPAPAPDRRVLPRKPNLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pyrococcus abyssi UPF0282 protein PYRAB09800 (PYRAB09800)
MBS1321856-01 0.02 mg (E-Coli)

Recombinant Pyrococcus abyssi UPF0282 protein PYRAB09800 (PYRAB09800)

Sign In for Pricing
View Details
Recombinant Pyrococcus abyssi UPF0282 protein PYRAB09800 (PYRAB09800)
MBS1321856-02 0.02 mg (Yeast)

Recombinant Pyrococcus abyssi UPF0282 protein PYRAB09800 (PYRAB09800)

Sign In for Pricing
View Details
Recombinant Pyrococcus abyssi UPF0282 protein PYRAB09800 (PYRAB09800)
MBS1321856-03 0.1 mg (E-Coli)

Recombinant Pyrococcus abyssi UPF0282 protein PYRAB09800 (PYRAB09800)

Sign In for Pricing
View Details
Recombinant Pyrococcus abyssi UPF0282 protein PYRAB09800 (PYRAB09800)
MBS1321856-04 0.1 mg (Yeast)

Recombinant Pyrococcus abyssi UPF0282 protein PYRAB09800 (PYRAB09800)

Sign In for Pricing
View Details
Recombinant Pyrococcus abyssi UPF0282 protein PYRAB09800 (PYRAB09800)
MBS1321856-05 0.02 mg (Baculovirus)

Recombinant Pyrococcus abyssi UPF0282 protein PYRAB09800 (PYRAB09800)

Sign In for Pricing
View Details
Recombinant Pyrococcus abyssi UPF0282 protein PYRAB09800 (PYRAB09800)
MBS1321856-06 0.02 mg (Mammalian-Cell)

Recombinant Pyrococcus abyssi UPF0282 protein PYRAB09800 (PYRAB09800)

Sign In for Pricing
View Details