Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Gap junction alpha-8 protein (GJA8)

This Recombinant Sheep Gap junction alpha-8 protein (GJA8) spans the amino acid sequence from region 2-440.

Product Specifications

Product Name Alternative

Gap junction alpha-8 protein, Connexin-49, Cx49, Lens fiber protein MP70, MP38, MP64

UniProt

P55917

Expression Region

2-440

Origin

Ovis aries (Sheep)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GDWSFLGNILEEVNEHSTVIGRVWLTVLFIFRILILGTAAEFVWGDEQSDFVCNTQQPGC ENVCYDEAFPISHIRLWVLQIIFVSTPSLVYVGHAVHHVRMEEKRKEREAEELSQQSPGN GGERAPLAADQGSVKKSSSSSKGTKKFRLEGTLLRTYVCHIIFKTLFEVGFIVGHYFLYG FRILPLYRCSRWPCPNVVDCFVSRPTEKTIFILFMLSVASVSLFLNILEMSHLGLKKIRS AFKRPVEQPLGEIPEKSLHSIAVSSIQKAKGYQLLEEEKIVSHYFPLTEVGMVEASPLSA KPFSQFEEKVGPGPLGDLSRAYQETLPSYAQVGAQEGVEEEQPIEAAAEPEVGDKSQEAE RVSTEGEETLAVLEEEKVEPPEVEKEAEKEETPPEKVSKQELTPEKAPSLCAELPGEDTR PLSRLSKASSRARSDDLTV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-epi-25-Hydroxy Vitamin D3-d6
TRC-H995862-2.5MG 2.5 mg

3-epi-25-Hydroxy Vitamin D3-d6

Sign In for Pricing
View Details
Phospho-Syk (Y352) Recombinant Rabbit monoclonal Antibody
HA751422 100 µL

Phospho-Syk (Y352) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
L-Tryptophan Benzyl Ester Hydrochloride
TRC-T147110-5G 5 g

L-Tryptophan Benzyl Ester Hydrochloride

Sign In for Pricing
View Details
TGFalpha (MF9), CF647 conjugate, 0.1mg/mL
BNC470644-100 1x 100 µL

TGFalpha (MF9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FABP5 (Marker of Metastatic Potential in Colorectal Cancer) (CPTC-FABP5-3), CF488A conjugate, 0.1mg/mL
BNC882225-100 1x 100 µL

FABP5 (Marker of Metastatic Potential in Colorectal Cancer) (CPTC-FABP5-3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PP-X Rabbit Polyclonal Antibody
HA500276 100 µL

PP-X Rabbit Polyclonal Antibody

Sign In for Pricing
View Details