Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Eastern equine encephalitis virus Structural polyprotein

This Recombinant Eastern equine encephalitis virus Structural polyprotein spans the amino acid sequence from region 802-1242.

Product Specifications

Product Name Alternative

Structural polyprotein, p130, Cleaved into the following 6 chains:, 1. Capsid protein, EC= 2. 3.4.21.90, Coat protein, C, p62, E3/E2

UniProt

Q4QXJ7

Expression Region

802-1242

Origin

Eastern equine encephalitis virus (strain Florida 91-469) (EEEV) (Eastern equine encephalomyelitis virus)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YEHTAVMPNKVGIPYKALVERPGYAPVHLQIQLVNTRIIPSTNLEYITCKYKTKVPSPVV KCCGATQCTSKPHPDYQCQVFTGVYPFMWGGAYCFCDTENTQMSEAYVERSEECSIDHAK AYKVHTGTVQAMVNITYGSVSWRSADVYVNGETPAKIGDAKLIIGPLSSAWSPFDNKVVV YGHEVYNYDFPEYGTGKAGSFGDLQSRTSTSNDLYANTNLKLQRPQAGIVHTPFTQAPSG FERWKRDKGAPLNDVAPFGCSIALEPLRAENCAVGSIPISIDIPDAAFTRISETPTVSDL ECKITECTYASDFGGIATVAYKSSKAGNCPIHSPSGVAVIKENDVTLAESGSFTFHFSTA NIHPAFKLQVCTSAVTCKGDCKPPKDHIVDYPAQHTESFTSAISATAWSWLKVLVGGTSA FIVLGLIATAVVALVLFFHRH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM76A Human Over-expression Lysate
orb1340431 100 µg

FAM76A Human Over-expression Lysate

Sign In for Pricing
View Details
Stk32b ORF Vector (Rat) (pORF)
ORF077158 1.0 µg DNA

Stk32b ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Ephrin B3 Rabbit Polyclonal Antibody (BF647)
orb2395458 100 µL

Ephrin B3 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
C-erbB2, p185 (HER2, neu Receptor) (Glycerol, BSA & Azide Free) (Biotin) discontinued
C0015X1-Biotin 100 µL

C-erbB2, p185 (HER2, neu Receptor) (Glycerol, BSA & Azide Free) (Biotin) discontinued

Sign In for Pricing
View Details
ERK 1/2 Polyclonal Antibody
MBS9243594-01 0.1 mL

ERK 1/2 Polyclonal Antibody

Sign In for Pricing
View Details
ERK 1/2 Polyclonal Antibody
MBS9243594-02 5x 0.1 mL

ERK 1/2 Polyclonal Antibody

Sign In for Pricing
View Details