Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Poly-beta-1,6-N-acetyl-D-glucosamine synthase (pgaC)

This Recombinant Poly-beta-1,6-N-acetyl-D-glucosamine synthase (pgaC) spans the amino acid sequence from region 1-441.

Product Specifications

Product Name Alternative

Poly-beta-1,6-N-acetyl-D-glucosamine synthase, PGA synthase, Poly-beta-1,6-GlcNAc synthase, EC= 2.4.1.-, Biofilm PGA synthesis protein PgaC, N-acetylglucosaminyltra

UniProt

Q8XAR5

Expression Region

1-441

Origin

Escherichia coli O157:H7

Field of Research

Metabolism Research; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MINRIVSFFILCLVLCIPLCVAYFHSGELMMRFVFFWPFFMSIMWIVGGVYFWVYRERRW PWGENAPAPQLKDNPSISIIIPCFNEEKNVEETIHAALAQRYENIEVIAVNDGSTDKTRA ILDRMAAQIPHLRVIHLAQNQGKAIALKTGAAAAKSEYLVCIDGDALLDRDAAAYIVEPM LYNPRVGAVTGNPRIRTRSTLVGKIQVGEYSSIIGLIKRTQRIYGNVFTVSGVIAAFRRS ALAEVGYWSDDMITEDIDISWKLQLNQWTIFYEPRALCWILMPETLKGLWKQRLRWAQGG AEVFLKNMTRLWRKENFRMWPLFFEYSLTTIWAFTCLVGFIIYAVQLAGVPLNIELTHIA ATHTAGILLCTLCLLQFIVSLMIENRYEHNLTSSLFWIIWFPVIFWMLSLATTLVSFTRV MLMPKKQRARWVSPDRGILRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-[4-(3-Chlorophenyl)piperazin-1-yl]propyl Isobutyl Ether Dihydrochloride
TRC-C379495-50MG 50 mg

3-[4-(3-Chlorophenyl)piperazin-1-yl]propyl Isobutyl Ether Dihydrochloride

Sign In for Pricing
View Details
Cytokeratin, HMW (KRTH/1076), CF640R conjugate, 0.1mg/mL
BNC401076-100 1x 100 µL

Cytokeratin, HMW (KRTH/1076), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD130 (IL6ST) Rabbit Polyclonal Antibody
AP06506PU-N 100 µg

CD130 (IL6ST) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike RBD (T393P) (His Tag)
PKSV030443 100 µg

Recombinant SARS-CoV-2 Spike RBD (T393P) (His Tag)

Sign In for Pricing
View Details
Tissue Total RNA, Jejunum
CR560012 5 µg

Tissue Total RNA, Jejunum

Sign In for Pricing
View Details
Human carabin (TBC1D10C) activation kit by CRISPRa
GA117765 1 Kit

Human carabin (TBC1D10C) activation kit by CRISPRa

Sign In for Pricing
View Details