Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Venezuelan equine encephalitis virus Structural polyprotein

This Recombinant Venezuelan equine encephalitis virus Structural polyprotein spans the amino acid sequence from region 813-1254.

Product Specifications

Product Name Alternative

Structural polyprotein, p130, Cleaved into the following 6 chains:, 1. Capsid protein, EC= 2. 3.4.21.90, Coat protein, C, p62, E3/E2

UniProt

P05674

Expression Region

813-1254

Origin

Venezuelan equine encephalitis virus (strain TC-83) (VEEV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YEHATTMPSQAGISYNTIVNRAGYAPLPISITPTKIKLIPTVNLEYVTCHYKTGMDSPAI KCCGSQECTPTYRPDEQCKVFTGVYPFMWGGAYCFCDTENTQVSKAYVMKSDDCLADHAE AYKAHTASVQAFLNITVGEHSIVTTVYVNGETPVNFNGVKITAGPLSTAWTPFDRKIVQY AGEIYNYDFPEYGAGQPGAFGDIQSRTVSSSDLYANTNLVLQRPKAGAIHVPYTQAPSGF EQWKKDKAPSLKFTAPFGCEIYTNPIRAENCAVGSIPLAFDIPDALFTRVSETPTLSAAE CTLNECVYSSDFGGIATVKYSASKSGKCAVHVPSGTATLKEAAVELTEQGSATIHFSTAN IHPEFRLQICTSYVTCKGDCHPPKDHIVTHPQYHAQTFTAAVSKTAWTWLTSLLGGSAVI IIIGLVLATIVAMYVLTNQKHN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Crude Laburnum alpinum Lectin (Scotch Laburnum) -LAA-
L-5300-100 100 mg

Crude Laburnum alpinum Lectin (Scotch Laburnum) -LAA-

Sign In for Pricing
View Details
ZNF592 Human Gene Knockout Kit (CRISPR)
KN419739 1 Kit

ZNF592 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SLC2A6 (NM_017585) Human Recombinant Protein
TP304391 20 µg

SLC2A6 (NM_017585) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Mouse SIGIRR/TIR8 Protein (His & Fc Tag)
PKSM040853 100 µg

Recombinant Mouse SIGIRR/TIR8 Protein (His & Fc Tag)

Sign In for Pricing
View Details
Tissue Total RNA, Kidney
CR562034 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details
Human KLHL13 activation kit by CRISPRa
GA113997 1 Kit

Human KLHL13 activation kit by CRISPRa

Sign In for Pricing
View Details