Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Venezuelan equine encephalitis virus Structural polyprotein

This Recombinant Venezuelan equine encephalitis virus Structural polyprotein spans the amino acid sequence from region 814-1255.

Product Specifications

Product Name Alternative

Structural polyprotein p130Cleaved into the following 6 chains: 1. Capsid protein EC= 2. 3.4.21.90 Coat protein C p62 E3/E2 E3 prote

UniProt

P36332

Expression Region

814-1255

Origin

Venezuelan equine encephalitis virus (strain P676) (VEEV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YEHATTMPSQAGISYNTIVNRAGYAPLPISITPTKIKLIPTVNLEYVTCHYKTGMDSPAI KCCGSQECTPTNRPDEQCKVFTGVYPFMWGGAYCFCDTENTQVSKAYVMKSDDCLADHAE AYKAHTASVQAFLNITVGEHSIVTTVYVNGETPVNFNGVKLTAGPLSTAWTPFDRKIVQY AGEIYNYDFPEYGAGQPGAFGDIQSRTVSSSDLYANTNLVLQRPKAGAIHVPYTQAPSGF EQWKKDKAPSLKFTAPFGCEIYTNPIRAENCAVGSIPLAFDIPDALFTRVSETPTLSAAE CTLNECVYSSDFGGIATVKYSASKSGKCAVHVPSGTATLKEAAVELTEQGSATIHFSTAN IHPEFRLQICTSYVTCKGDCHPPKDHIVTHPQYHAQTFTAAVSKTAWTWLTSLLGGSAVI IIIGLVLATIVAMYVLTNQKHN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cmtr1 Mouse qPCR Template Standard (NM_028791)
MK201511 1 Kit

Cmtr1 Mouse qPCR Template Standard (NM_028791)

Sign In for Pricing
View Details
SLAMF7 (CS1, SLAM Family Member 7, CD2 Subset 1, CD2-like Receptor-activating Cytotoxic Cells, CRACC, Membrane Protein FOAP-12, Novel Ly9, Protein 19A, CD319, UNQ576/PRO1138) (MaxLight 405) discontinued
133392-ML405 100 µL

SLAMF7 (CS1, SLAM Family Member 7, CD2 Subset 1, CD2-like Receptor-activating Cytotoxic Cells, CRACC, Membrane Protein FOAP-12, Novel Ly9, Protein 19A, CD319, UNQ576/PRO1138) (MaxLight 405) discontinued

Sign In for Pricing
View Details
LRRC32 Rabbit Polyclonal Antibody (PE)
orb2607185 100 µg

LRRC32 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Human Potassium Inwardly Rectifying Channel Subfamily J, Member 10 (KCNJ10) ELISA Kit
DLR-KCNJ10-Hu-96T 96 Tests

Human Potassium Inwardly Rectifying Channel Subfamily J, Member 10 (KCNJ10) ELISA Kit

Sign In for Pricing
View Details
Human Protein S (Total) AssayMax ELISA Kit (Positive Control included)
EP1331-7 96 Well Plate

Human Protein S (Total) AssayMax ELISA Kit (Positive Control included)

Sign In for Pricing
View Details
Olfr222 ORF Vector (Mouse) (pORF)
32998014 1.0 µg DNA

Olfr222 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details