Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Venezuelan equine encephalitis virus Structural polyprotein

This Recombinant Venezuelan equine encephalitis virus Structural polyprotein spans the amino acid sequence from region 813-1254.

Product Specifications

Product Name Alternative

Structural polyprotein p130Cleaved into the following 6 chains: 1. Capsid protein EC= 2. 3.4.21.90 Coat protein C p62 E3/E2 E3 prote

UniProt

P36330

Expression Region

813-1254

Origin

Venezuelan equine encephalitis virus (strain Everglades Fe3-7c) (VEEV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YEHATTMPNQAGISYNTIVNRAGYAPLPISITPTKIKLIPTVNLEYVTCHYKTGMDSPTI KCCGSQECTPTYRPDEQCKVFAGVYPFMWGGAYCFCDTENTQISKAYVMKSEDCLADHAA AYKAHTASVQALLNITVGEHSTVTTVYVNGETPVNFNGVKLTAGPLSTAWTPFDRKIVQY AGEIYNYDFPEYGAGQPGAFGDIQLRTVSSSDLYANTNLVLQRPKAGAIHVPYTQAPSGF EQWKKDKAPSLKFTAPFGCEIYTNPIRAENCAVGSIPLAFDIPDALFTRVSETPTLSAAE CTLNECVYSSDFGGIATVKYSASKSGKCAVHVPSGTATLKEASVELAEQGSVTIHFSTAN IHPEFRLQICTSFVTCKGDCHPPKDHIVTHPQYHAQTFTAAVSKTAWTWLTSLLGGSAVI IIIGLVLATLVAMYVLTNQKHN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human HDDC3 shRNA (UAS) - Lentiviral human HDDC3 shRNA (UAS, iRFP) plasmid
GTR15307411 1 Vial

Lentiviral human HDDC3 shRNA (UAS) - Lentiviral human HDDC3 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
ADORA3 Antibody
MBS7121767-01 0.05 mg

ADORA3 Antibody

Sign In for Pricing
View Details
ADORA3 Antibody
MBS7121767-02 0.1 mg

ADORA3 Antibody

Sign In for Pricing
View Details
ADORA3 Antibody
MBS7121767-03 5x 0.1 mg

ADORA3 Antibody

Sign In for Pricing
View Details
SEMA3C, CT (SEMA3C, SEMAE, Semaphorin-3C, Semaphorin-E) (MaxLight 650)
MBS6345973-01 0.1 mL

SEMA3C, CT (SEMA3C, SEMAE, Semaphorin-3C, Semaphorin-E) (MaxLight 650)

Sign In for Pricing
View Details
SEMA3C, CT (SEMA3C, SEMAE, Semaphorin-3C, Semaphorin-E) (MaxLight 650)
MBS6345973-02 5x 0.1 mL

SEMA3C, CT (SEMA3C, SEMAE, Semaphorin-3C, Semaphorin-E) (MaxLight 650)

Sign In for Pricing
View Details