Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized PPE family protein PPE13 (ppe13)

This Recombinant Uncharacterized PPE family protein PPE13 (ppe13) spans the amino acid sequence from region 1-443.

Product Specifications

Product Name Alternative

Uncharacterized PPE family protein PPE13

UniProt

Q10540

Expression Region

1-443

Origin

Mycobacterium tuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNFMVLPPEVNSARIYAGAGPAPMLAAAVAWDGLAAELGMAAASFSLLISGLTAGPGSAW QGPAAAAMAAAAAPYLSWLNAATARAEGAAAGAKAAAAVYEAARAATAHPALVAANRNQL LSLVLSNLFGQNLPAIAATEASYEQLWAQDVAAMVGYHGGASTVASQLTPWQQLLSVLPP VVTAAPAGAVGVPAALAIPALGVENIGVGNFLGIGNIGNNNVGSGNTGDYNFGIGNIGNA NLGNGNIGNANLGSGNAGFFNFGNGNDGNTNFGSGNAGFLNIGSGNEGSGNLGFGNAGDD NTGWGNSGDTNTGGFNSGDLNTGIGSPVTQGVANSGFGNTGTGHSGFFNSGNSGSGFQNL GNGSSGFGNASDTSSGFQNAGTALTRASSTWADSPRAWPIRAPSRLQVWRTRATTARECS IRVIISRVSSTGAPPQKKVGNSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NGFR (Nerve Growth Factor Receptor) (NGFR5 + NTR/912), CF488A conjugate, 0.1mg/mL
BNC880914-100 1x 100 µL

NGFR (Nerve Growth Factor Receptor) (NGFR5 + NTR/912), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Pancreas
CR560681 5 µg

Tissue Total RNA, Pancreas

Sign In for Pricing
View Details
Lupersol 533-M75
TRC-L474870-10MG 10 mg

Lupersol 533-M75

Sign In for Pricing
View Details
Uncoated Rat MCSF (Macrophage Colony Stimulating Factor 1) ELISA Kit
E-UNEL-R0093-01 5x 96 Tests

Uncoated Rat MCSF (Macrophage Colony Stimulating Factor 1) ELISA Kit

Sign In for Pricing
View Details
Uncoated Rat MCSF (Macrophage Colony Stimulating Factor 1) ELISA Kit
E-UNEL-R0093-02 15x 96 Tests

Uncoated Rat MCSF (Macrophage Colony Stimulating Factor 1) ELISA Kit

Sign In for Pricing
View Details
CD63 (Late Endosomes Marker) (LAMP3/2790), CF568 conjugate, 0.1mg/mL
BNC682790-100 1x 100 µL

CD63 (Late Endosomes Marker) (LAMP3/2790), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details