Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human RING finger and transmembrane domain-containing protein 2 (RNFT2)

This Recombinant Human RING finger and transmembrane domain-containing protein 2 (RNFT2) spans the amino acid sequence from region 1-444.

Product Specifications

Product Name Alternative

RING finger and transmembrane domain-containing protein 2

UniProt

Q96EX2

Expression Region

1-444

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWLFTVNQVLRKMQRRHSSNTDNIPPERNRSQALSSEASVDEGGVFESLKAEAASPPALF SGLSGSLPTSSFPSSLVLGSSAGGGDVFIQMPASREEGGGRGEGGAYHHRQPHHHFHHGG HRGGSLLQHVGGDHRGHSEEGGDEQPGTPAPALSELKAVICWLQKGLPFILILLAKLCFQ HKLGIAVCIGMASTFAYANSTLREQVSLKEKRSVLVILWILAFLAGNTLYVLYTFSSQQL YNSLIFLKPNLEMLDFFDLLWIVGIADFVLKYITIALKCLIVALPKIILAVKSKGKFYLV IEELSQLFRSLVPIQLWYKYIMGDDSSNSYFLGGVLIVLYSLCKSFDICGRVGGVRKALK LLCTSQNYGVRATGQQCTEAGDICAICQAEFREPLILLCQHVFCEECLCLWLDRERTCPL CRSVAVDTLRCWKDGATSAHFQVY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UNC119 binding protein C5orf30 (C5orf30) Human qPCR Primer Pair (NM_033211)
HP216364 200 Reactions

UNC119 binding protein C5orf30 (C5orf30) Human qPCR Primer Pair (NM_033211)

Sign In for Pricing
View Details
LRP1B Protein Lysate (Mouse) with C-HA Tag
27606034 100 µg

LRP1B Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
PDK4 Blocking Peptide
33R-6121 100 ug

PDK4 Blocking Peptide

Sign In for Pricing
View Details
CHMP4B Antibody
GWB-MT028A 50 µg

CHMP4B Antibody

Sign In for Pricing
View Details
Mouse BH3 Interacting Domain Death Agonist (Bid) ELISA Kit
MBS2702178-01 24 Strip Well

Mouse BH3 Interacting Domain Death Agonist (Bid) ELISA Kit

Sign In for Pricing
View Details
Mouse BH3 Interacting Domain Death Agonist (Bid) ELISA Kit
MBS2702178-02 48 Well

Mouse BH3 Interacting Domain Death Agonist (Bid) ELISA Kit

Sign In for Pricing
View Details