Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human RING finger and transmembrane domain-containing protein 2 (RNFT2)

This Recombinant Human RING finger and transmembrane domain-containing protein 2 (RNFT2) spans the amino acid sequence from region 1-444.

Product Specifications

Product Name Alternative

RING finger and transmembrane domain-containing protein 2

UniProt

Q96EX2

Expression Region

1-444

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWLFTVNQVLRKMQRRHSSNTDNIPPERNRSQALSSEASVDEGGVFESLKAEAASPPALF SGLSGSLPTSSFPSSLVLGSSAGGGDVFIQMPASREEGGGRGEGGAYHHRQPHHHFHHGG HRGGSLLQHVGGDHRGHSEEGGDEQPGTPAPALSELKAVICWLQKGLPFILILLAKLCFQ HKLGIAVCIGMASTFAYANSTLREQVSLKEKRSVLVILWILAFLAGNTLYVLYTFSSQQL YNSLIFLKPNLEMLDFFDLLWIVGIADFVLKYITIALKCLIVALPKIILAVKSKGKFYLV IEELSQLFRSLVPIQLWYKYIMGDDSSNSYFLGGVLIVLYSLCKSFDICGRVGGVRKALK LLCTSQNYGVRATGQQCTEAGDICAICQAEFREPLILLCQHVFCEECLCLWLDRERTCPL CRSVAVDTLRCWKDGATSAHFQVY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Ahsg/Alpha-2-HS-glycoprotein ELISA Kit
E0045Ra 96 Tests

Rat Ahsg/Alpha-2-HS-glycoprotein ELISA Kit

Sign In for Pricing
View Details
Lentiviral human GALNT17 sgRNA gene knockout kit - Lentiviral human GALNT17 sgRNA gene knockout kit (25)
GTR15362817 1 Vial

Lentiviral human GALNT17 sgRNA gene knockout kit - Lentiviral human GALNT17 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
OLIG2 (Oligodendrocyte Transcription Factor 2, Oligo2, Class B Basic Helix-loop-helix Protein 1, bHLHb1, Class E Basic Helix-loop-helix Protein 19, bHLHe19, Protein Kinase C-binding Protein 2, Protein Kinase C-binding Protein RACK17, BHLHB1, BHLHE19, PRKC
MBS6132705-01 0.1 mL

OLIG2 (Oligodendrocyte Transcription Factor 2, Oligo2, Class B Basic Helix-loop-helix Protein 1, bHLHb1, Class E Basic Helix-loop-helix Protein 19, bHLHe19, Protein Kinase C-binding Protein 2, Protein Kinase C-binding Protein RACK17, BHLHB1, BHLHE19, PRKC

Sign In for Pricing
View Details
OLIG2 (Oligodendrocyte Transcription Factor 2, Oligo2, Class B Basic Helix-loop-helix Protein 1, bHLHb1, Class E Basic Helix-loop-helix Protein 19, bHLHe19, Protein Kinase C-binding Protein 2, Protein Kinase C-binding Protein RACK17, BHLHB1, BHLHE19, PRKC
MBS6132705-02 5x 0.1 mL

OLIG2 (Oligodendrocyte Transcription Factor 2, Oligo2, Class B Basic Helix-loop-helix Protein 1, bHLHb1, Class E Basic Helix-loop-helix Protein 19, bHLHe19, Protein Kinase C-binding Protein 2, Protein Kinase C-binding Protein RACK17, BHLHB1, BHLHE19, PRKC

Sign In for Pricing
View Details
PPHLN1 Polyclonal Antibody, APC-Cy7 Conjugated
bs-7872R-APC-Cy7 100 µL

PPHLN1 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
AX-024 hydrochloride 10mg
A18332-10 10 mg

AX-024 hydrochloride 10mg

Sign In for Pricing
View Details