Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Psilotum nudum Chloroplast envelope membrane protein (cemA)

This Recombinant Psilotum nudum Chloroplast envelope membrane protein (cemA) spans the amino acid sequence from region 1-449.

Product Specifications

Product Name Alternative

Chloroplast envelope membrane protein

UniProt

Q8WI08

Expression Region

1-449

Origin

Psilotum nudum (Whisk fern) (Lycopodium nudum)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNMELNNSVFLIYWSLLECKFSIFVLNFWNRWKHILLYKFSSPISIYNHLSSRSKNRISS REYFFNMNIRDPILNTYFYLSFLFERIGLKKDEDVGKLKRNRIFDIFDERSKENRLVYAV KYMSKKSNNREKMNRRLAWIETTLNDLRICKKYFYNFPFSVEIKDRLDEELSISKSIELT VPTTIAYESINIVPRSITRTLSRFKAELIGQSSSLVLHEFKLAKYQALASLRYMGCLLFL PFFISSISKKWVLEPRIKDWWNTSQFQIFINHLQEKKALKRLQDVEELLWLDRIILEEDH SKDLSIKIREKTVQLVAIYNEDSIQIILNLLTDIISFTILSVLVIIGKKRLAVSNSWIQE LFHSLSDTMKAFFILLLTDLFIGFHSPHGWEIIIGSILEHIGFAYDKYTISYFVSTFPVI LDTVFKYWIFRHLNRLSPSIVATYHTMNE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL
BNC680679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF568 conjugate, 0.1mg/mL
BNC680040-100 1x 100 µL

CD35 / CR1 (E11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF700 conjugate, 0.1mg/mL
BNC000437-100 1x 100 µL

CD47 (B6H12.2), CF700 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF405S conjugate, 0.1mg/mL
BNC040322-500 1x 500 µL

CD3e (RIV9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL
BNC041231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF488A conjugate, 0.1mg/mL
BNC881037-500 1x 500 µL

CD44 Standard (DF1485), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details