Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Bifunctional apoptosis regulator (Bfar)

This Recombinant Mouse Bifunctional apoptosis regulator (Bfar) spans the amino acid sequence from region 1-450.

Product Specifications

Product Name Alternative

Bifunctional apoptosis regulator

UniProt

Q8R079

Expression Region

1-450

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEEPQKNDLSMREQEEEHPVRSSGPQISVSEFSCHCCYDTLVNPTTLNCGHSFCRHCLAL WWMSSKKTECPECREKWEGFPKVNILLRDAIEKLFPDAIRMRVEDIQQNNDVVQSLAAFQ KYGNDQNPLAPSTGRVNPQRGGGFFSGVLTALTGVAVILLVYHWRSRESEHGLLVHKAVD KWTMEEVVLWLEQLGPWASLYRDRFLSERVNGRLLLTLTEEEFSRAPYTIENSSHRRVIL TELERVRALGVKPPQNLWEYKAVNPGRSLFLLYALKSSPRLGLLYLYLFDYTDCFLPFIH TICPLQENSSGEDIFTKLLDLREPTWKQWREFLVKYSFLPYQLIAEFAWDWLEVHYWTSR FLIVNAVLLSVLELFSFWRIWSRSELKTVPQRMWSHFWKVSTQGLFMAMFWPLIPQFVCN CLFYWALYFNPIINIDLVVKEVRRLETQVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGFLAM Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-11346R-BF594 100 µL

EGFLAM Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
PCDHB3 Antibody - N-terminal region
OAAB08400-400UL 400 µL

PCDHB3 Antibody - N-terminal region

Sign In for Pricing
View Details
LHX6 (LIM/Homeobox Protein Lhx6, LIM Homeobox Protein 6, LIM/Homeobox Protein Lhx6.1, LHX6.1) APC
MBS6137401-01 0.1 mL

LHX6 (LIM/Homeobox Protein Lhx6, LIM Homeobox Protein 6, LIM/Homeobox Protein Lhx6.1, LHX6.1) APC

Sign In for Pricing
View Details
LHX6 (LIM/Homeobox Protein Lhx6, LIM Homeobox Protein 6, LIM/Homeobox Protein Lhx6.1, LHX6.1) APC
MBS6137401-02 5x 0.1 mL

LHX6 (LIM/Homeobox Protein Lhx6, LIM Homeobox Protein 6, LIM/Homeobox Protein Lhx6.1, LHX6.1) APC

Sign In for Pricing
View Details
PI 3 kinase p110 alpha Polyclonal Antibody
RD70170A-01 20 µL

PI 3 kinase p110 alpha Polyclonal Antibody

Sign In for Pricing
View Details
PI 3 kinase p110 alpha Polyclonal Antibody
RD70170A-02 60 μL

PI 3 kinase p110 alpha Polyclonal Antibody

Sign In for Pricing
View Details