Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cyanothece sp. Proton extrusion protein PcxA (pcxA)

This Recombinant Cyanothece sp. Proton extrusion protein PcxA (pcxA) spans the amino acid sequence from region 1-453.

Product Specifications

Product Name Alternative

Proton extrusion protein PcxA

UniProt

B1X0Z7

Expression Region

1-453

Origin

Cyanothece sp. (strain ATCC 51142)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKFRSLIKKTSNWLTATPERSLDNAYKAALKIKEIEDNHFGGKKVSKENADYGDSVISYF KTEVNGYLQKINMGLGVFKTSRLFLNISNIQELPQERPTERELQKNATTAAIIFEKLEFI DQVASKYQSRDTQEVYNGSLVLAKESSQDKETQTLDNKSTNQTNSKLSNNNKISSGQNDS RLESASQKTGVLPRSFINTLNKIKQEIDPKSGESEEQVLNKYRKSRLRTALSIKFILLLI IVPLLTHQLTKTFLLTPIIHQYFQNHEQVVFINKDLEEEAFEELSHYEEILRFQGLIGLR EPLTDEEVEEKVQEKAREITEEYRAQGIDSIGNVFADLFSVTAFAIVIVSSRKEIEVLKS FLDEILYGLSDPAKAFLIILFTDMFVGFHSPHGWEVILEGVARHFGLPENQEFNFLFIAT FPVILDTVLKYWIFRYLNRISPSAVATYKNMNE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL
BNC740226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF594 conjugate, 0.1mg/mL
BNC942853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL
BNC680304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF568 conjugate, 0.1mg/mL
BNC680345-100 1x 100 µL

CD4 (EDU-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF594 conjugate, 0.1mg/mL
BNC940352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD19 (CVID3/429), CF568 conjugate, 0.1mg/mL
BNC680429-500 1x 500 µL

CD19 (CVID3/429), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details