Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zygnema circumcarinatum Chloroplast envelope membrane protein (cemA)

This Recombinant Zygnema circumcarinatum Chloroplast envelope membrane protein (cemA) spans the amino acid sequence from region 1-453.

Product Specifications

Product Name Alternative

Chloroplast envelope membrane protein

UniProt

Q32RG7

Expression Region

1-453

Origin

Zygnema circumcarinatum (Green alga)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MCCYLNLLMIQFESSHICHWFWNTPYRALQRAYKASKKVRNIHTNYIFCKSKPAFQRFGY NLDLYIDSILDESSFQIYWGLLEFKASRFVLTKFSNLIFKHNFHLLTQTDGNKLFSNSFD REQSLLFCDIHSTSLKIINRKLAWIEAALADLEMLRDNSSSTSITPILNKVYNVSLPMSL DSTSKRVAYESVGLVPRSITRTFARFQTELAGRSVSVVLPEFRLAKYQATASVQYMACLI FLPWVFSTICKIIFLQPLVSHYWDTMQTQVFFNASQEQRALRRLQQIEELLWLDIVIASV PNKHLQDIAGEIHNKTLELVDIYNRESICTILNLLTDWISITCLACLLTWGKKRLAIFNS WIQELFYSLSDTMKAFFILLLTDLCIGFHSPHGWEIIITLFLEHIGFAHNKYVVSCFVST FPVILDTVLKYWIFRHLNRISPSIVVTYHTMNE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD7 (T3-3A1), CF405S conjugate, 0.1mg/mL
BNC040978-100 1x 100 µL

CD7 (T3-3A1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF640R conjugate, 0.1mg/mL
BNC400342-100 1x 100 µL

CD43 (84-3C1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF488A conjugate, 0.1mg/mL
BNC880304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (rGROEL/780), CF640R conjugate, 0.1mg/mL
BNC402207-100 1x 100 µL

HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (rGROEL/780), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pgp9.5 (UCHL-1) (13C4), CF405S conjugate, 0.1mg/mL
BNC040147-500 1x 500 µL

Pgp9.5 (UCHL-1) (13C4), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CDX2 / Caudal Type Homeobox 2 (GI Epithelial Marker) (PCRP-CDX2-1A3), CF640R conjugate, 0.1mg/mL
BNC401920-100 1x 100 µL

CDX2 / Caudal Type Homeobox 2 (GI Epithelial Marker) (PCRP-CDX2-1A3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details