Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterococcus faecalis Magnesium transporter mgtE (mgtE)

This Recombinant Enterococcus faecalis Magnesium transporter mgtE (mgtE) spans the amino acid sequence from region 1-453.

Product Specifications

Product Name Alternative

Magnesium transporter mgtE

UniProt

Q830V1

Expression Region

1-453

Origin

Enterococcus faecalis (strain ATCC 700802 / V583)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNEGQEMEEQFALLLETLKNQQMNEFRELFLALHIYEQGQFYQSLDEKDRQHLYNYLSPK ELADMFDVIEEDNENMKDYLAEMRPSYAADMLAEMYTDNAVDLLNMLDKSQKAKYLSLLS SEEAGEIKELLHYEDETAGAIMTTEFVSIVANQTVRSAMYVLKNQADMAETIYYVYVVDQ ENHLVGVISLRDLIVNDDDTLIADILNERVISVHVGDDQEDVAQTIRDYDFLAVPVTDYD DHLLGIVTVDDIIDVIDDEAASDYSGLAGVDVEEVSENPLKAASKRLPWLITLLFLGMST ASLISNYESLVSEASILAVFISLITGTAGNAGTQSLAVAVRRLAMKDEKDSNFGRLILSE VLTGLVTGAVTGLTIMIVVGVWQHNLPLGFVIGMAMLCAITVANLAGSLIPMLMDKLGFD PAVASGPFITTLSDLTSVLIYFNIASMFMRYFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SFRS17A, ID (AKAP17A, CXYorf3, DXYS155E, SFRS17A, XE7, A-kinase anchor protein 17A, 721P, B-lymphocyte antigen, Protein XE7, Protein kinase A-anchoring protein 17A, Splicing factor, arginine/serine-rich 17A) (MaxLight 405)
MBS6346674-01 0.1 mL

SFRS17A, ID (AKAP17A, CXYorf3, DXYS155E, SFRS17A, XE7, A-kinase anchor protein 17A, 721P, B-lymphocyte antigen, Protein XE7, Protein kinase A-anchoring protein 17A, Splicing factor, arginine/serine-rich 17A) (MaxLight 405)

Sign In for Pricing
View Details
SFRS17A, ID (AKAP17A, CXYorf3, DXYS155E, SFRS17A, XE7, A-kinase anchor protein 17A, 721P, B-lymphocyte antigen, Protein XE7, Protein kinase A-anchoring protein 17A, Splicing factor, arginine/serine-rich 17A) (MaxLight 405)
MBS6346674-02 5x 0.1 mL

SFRS17A, ID (AKAP17A, CXYorf3, DXYS155E, SFRS17A, XE7, A-kinase anchor protein 17A, 721P, B-lymphocyte antigen, Protein XE7, Protein kinase A-anchoring protein 17A, Splicing factor, arginine/serine-rich 17A) (MaxLight 405)

Sign In for Pricing
View Details
RPL26P21 3'UTR GFP Stable Cell Line
TU071186 1.0 mL

RPL26P21 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Compound NP-024200
T128149-01 10 mg

Compound NP-024200

Sign In for Pricing
View Details
Compound NP-024200
T128149-02 1 g

Compound NP-024200

Sign In for Pricing
View Details
Compound NP-024200
T128149-03 1 mg

Compound NP-024200

Sign In for Pricing
View Details