Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cyanothece sp. Proton extrusion protein PcxA (pcxA)

This Recombinant Cyanothece sp. Proton extrusion protein PcxA (pcxA) spans the amino acid sequence from region 1-457.

Product Specifications

Product Name Alternative

Proton extrusion protein PcxA

UniProt

B7KHV5

Expression Region

1-457

Origin

Cyanothece sp. (strain PCC 7424) (Synechococcus sp. (strain ATCC 29155) )

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKLSRIVRGANQWLSKTPERALDQAYRAALKIKELEDKHFQGKKVSPDTAQYGDSVMTYF EAELQGYLQTIKVRLGVFKTSRLFTSLSEPTHPRDERIALEQDSHGNRLLQKLKFIDDVI SKYKTNEIVTAHSSDNGVIRGSELTPLNQQQVVIEANGKVPPPKKTNPQPAKKLTNLTVD EPKNKLDSATDKTGVLPRSFLNTINRIKQEIDPKSEETEEAVLKRFRTSRYKTAISIKFI LLLIIVPLLTHQLTKTFFLTPVVEHYFSQHEQVVFINKDLEEEAFVELRSFEEALHFKSL IGIIPKLTQEEIEQEVRLKAEEISESYRLEGINAISNVFADIFSLIAFGVVIATSRKEIE IVKSFLDGILYSLSDSAKAFLIILFTDMFVGFHSPHGWEVILEGVARHFGLPENRDFNFL FIATFPVILDTVLKYWIFRYLNRISPSAVATYRNMNE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Collagen V (COL5A1) Human Gene Knockout Kit (CRISPR)
KN212443 1 Kit

Collagen V (COL5A1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DPH2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A12]
TA504855AM 100 µL

DPH2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A12]

Sign In for Pricing
View Details
ZFAND1 (NM_024699) Human Recombinant Protein
TP324679 20 µg

ZFAND1 (NM_024699) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Mouse CD4/LEU3 protein (His tag)
PDMM100204-01 20 µg

Recombinant Mouse CD4/LEU3 protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse CD4/LEU3 protein (His tag)
PDMM100204-02 100 µg

Recombinant Mouse CD4/LEU3 protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse CD4/LEU3 protein (His tag)
PDMM100204-03 500 µg

Recombinant Mouse CD4/LEU3 protein (His tag)

Sign In for Pricing
View Details