Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ectopic P granules protein 3 (epg-3)

This Recombinant Ectopic P granules protein 3 (epg-3) spans the amino acid sequence from region 1-458.

Product Specifications

Product Name Alternative

Ectopic P granules protein 3

UniProt

Q9XWU8

Expression Region

1-458

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAKKQKKSTEKSERTVEFKEPPKPANSEERLKPAGRGMKPSPSQNTLNRMERETIVFWRR PHIVIPYALMEIAHLAVELFFKILAHKTVLLLTAISIGLAVYGYHAPGAHQEHVQTIEKH ILWWSWWVLLGVLSSIGLGSGLHTFLIYLGPHIAAVTMAAYECQSLDFPQPPYPESIQCP STKSSIAVTFWQIVAKVRVESLLWGAGTALGELPPYFMARAARISGQEPDDEEYREFLEL MNADKESDADQKLSIVERAKSWVEHNIHRLGFPGILLFASIPNPLFDLAGITCGHFLVPF WSFFGATLIGKALVKMHVQMGFVILAFSDHHAENFVKILEKIPAVGPYIRQPISDLLEKQ RKALHKTPGEHSEQSTSYLAWGLSLMVTFMILFFFLSIVNSLAKDYHKRLWERKRRQNKD LIDEENQSFEEEEEEAVTPPSSCPLLLSDGFEGVVVKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IFN-alpha/beta R1 Alexa Fluor 405 Antibody (1056928)
FAB2451V-100UG 100 µg

Human IFN-alpha/beta R1 Alexa Fluor 405 Antibody (1056928)

Sign In for Pricing
View Details
Lentiviral human SERPING1 shRNA (UAS) - Lentiviral human SERPING1 shRNA (UAS, GFP) plasmid
GTR15324553 1 Vial

Lentiviral human SERPING1 shRNA (UAS) - Lentiviral human SERPING1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Cytochrome P450 Reductase (POR) Mouse Monoclonal Antibody [Clone ID: LBI3H10]
AMM09237V 100 µL

Cytochrome P450 Reductase (POR) Mouse Monoclonal Antibody [Clone ID: LBI3H10]

Sign In for Pricing
View Details
RGD1308409 3'UTR GFP Stable Cell Line
TU267774 1.0 mL

RGD1308409 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
SELM Rabbit Polyclonal Antibody
orb1175778 100 µg

SELM Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
G-Protein Coupled Receptor 1, Very Large (VLGR1, GPR98, mass1, monogenic audiogenic seizure-susceptible gene, very large g-protein coupled receptor-1)
G8600-04R 50 µg

G-Protein Coupled Receptor 1, Very Large (VLGR1, GPR98, mass1, monogenic audiogenic seizure-susceptible gene, very large g-protein coupled receptor-1)

Sign In for Pricing
View Details