Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Carassius auratus Neuronal acetylcholine receptor subunit beta-2 (chrnb2)

This Recombinant Carassius auratus Neuronal acetylcholine receptor subunit beta-2 (chrnb2) spans the amino acid sequence from region 1-459.

Product Specifications

Product Name Alternative

Neuronal acetylcholine receptor subunit beta-2, GF-beta-2

UniProt

P19370

Expression Region

1-459

Origin

Carassius auratus (Goldfish)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LRSDFLLGPERYNKLIRPAVNKSQQVTIGIKVSLAQLISVNEREQIMTTNVWLTQEWTDY RLVWDPNEYEGIKKLRIPSQHIWLPDIVLYNNADGVYEVSFYCNAVVSNTGDIFWLPPAI YKSACAIEVRNFPFDQQNCTLKFRSWTYDRTELDLVLTSDFASRDDYTPSGEWDIVSLPG RKNEDPNDLTYLDITYDFVIKRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKVTLCM SVLLALTVFLLLISKIVPPTSLAVPLIGKYLMFTMVLVTFSIVTSVCVLNVHHRSPSTHY MPEWVKCVFLHKLPAFLLMRRPGRSNVRERFRRKHQRKSFSSHQDGDSFFLTDDPGRVCG AWRVGDLPEGSEFRQRVKVRHDQDVDEAIDGVRFIAEHMKIEDDDEGIIEDWKYVAMVID RLFLWIFILVCVVGTLGLFVQPLFQSYNTPVAEEVYGDF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8/18 (C-51), CF740 conjugate, 0.1mg/mL
BNC740034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF594 conjugate, 0.1mg/mL
BNC940151-100 1x 100 µL

CD11a (Cris-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL
BNC942216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF405S conjugate, 0.1mg/mL
BNC040633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), 0.2mg/mL
BNUB0304-100 1x 100 µL

CD106 / VCAM1 (B-K9), 0.2mg/mL

Sign In for Pricing
View Details
Laminin (A5), CF647 conjugate, 0.1mg/mL
BNC470308-500 1x 500 µL

Laminin (A5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details