Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmon pancreas disease virus Structural polyprotein

This Recombinant Salmon pancreas disease virus Structural polyprotein spans the amino acid sequence from region 860-1320.

Product Specifications

Product Name Alternative

Structural polyprotein, p130, Cleaved into the following 6 chains:, 1. Capsid protein, EC= 2. 3.4.21.-, Coat protein, C, p62, E3/E2

UniProt

Q8JJX0

Expression Region

860-1320

Origin

Salmon pancreas disease virus (SPDV)

Field of Research

Infectious Disease & Virology; Gastroenterology & Hepatology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YEHTVVVPMDPRAPSYEAVINRNGYDPLKLTISVNFTVISPTTALEYWTCAGVPIVEPPH VGCCTSVSCPSDLSTLHAFTGKAVSDVHCDVHTNVYPLLWGAAHCFCSTENTQVSAVAAT VSEFCAQDSERAEAFSVHSSSVTAEVLVTLGEVVTAVHVYVDGVTSARGTDLKIVAGPIT TDYSPFDRKVVRIGEEVYNYDWPPYGAGRPGTFGDIQARSTNYVKPNDLYGDIGIEVLQP TNDHVHVAYTYTTSGLLRWLQDAPKPLSVTAPHGCKISANPLLALDCGVGAVPMSINIPD AKFTRKLKDPKPSALKCVVDSCEYGVDYGGAATITYEGHEAGKCGIHSLTPGVPLRTSVV EVVAGANTVKTTFSSPTPEVALEVEICSAIVKCAGECTPPKEHVVATRPRHGSDPGGYIS GPAMRWAGGIVGTLVVLFLILAVIYCVVKKCRSKRIRIVKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2’-Deoxycytidine 5'-Monophosphate Hydrate
TRC-D232675-2.5G 2.5 g

2’-Deoxycytidine 5'-Monophosphate Hydrate

Sign In for Pricing
View Details
Amt siRNA Oligos set (Mouse)
11854174 3x 5 nmol

Amt siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Gamma-Aminobutyric Acid Receptor subunit α-2 (GABRA2) Mouse ELISA Kit
D5966 96 Tests

Gamma-Aminobutyric Acid Receptor subunit α-2 (GABRA2) Mouse ELISA Kit

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Tumor Protein p53 (TP53)
MBS2049594-01 0.1 mL

FITC-Linked Polyclonal Antibody to Tumor Protein p53 (TP53)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Tumor Protein p53 (TP53)
MBS2049594-02 0.2 mL

FITC-Linked Polyclonal Antibody to Tumor Protein p53 (TP53)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Tumor Protein p53 (TP53)
MBS2049594-03 0.5 mL

FITC-Linked Polyclonal Antibody to Tumor Protein p53 (TP53)

Sign In for Pricing
View Details