Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Adiantum capillus-veneris Chloroplast envelope membrane protein (cemA)

This Recombinant Adiantum capillus-veneris Chloroplast envelope membrane protein (cemA) spans the amino acid sequence from region 1-464.

Product Specifications

Product Name Alternative

Chloroplast envelope membrane protein

UniProt

Q85FL0

Expression Region

1-464

Origin

Adiantum capillus-veneris (Maidenhair fern)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAGNSSWARAAFTFKATVFKKSRYVIYYSLLEHRFSLSLWGILKYSGIYFCTEILRSFP KKRCKSHPYRVDGYPAGSCLDPPLHEPLDTSTPKKISLVSCSNSYMRNKTDNGKVGSRNV SEYKLEGDFASTSKSIYYKLNNLEKMNRKLAWIEAVSSEFSFWEKLRSKQIFPFQNEKDL IAEPFNYELAVSHRRPVIYESISLVPRSVTRTLSRFKAELTNQSNLNLSVHNKFDLAKNQ ASVSLQYVGFLLFLFPIQIAIENWFLEPRIRGWWNIRQIQLFSNVFQEENALKQLREAEA LFWLDDVIGNLADTQLQNFDTDARNETTRLAMMYDELNIQLLLRLATNAISIATLFPLLI FGRKRLAVLNSWIQELFYSLNDTMKAFSILLLTDLCVGFHSPHGWEILVQSLFEYFGLTP NKYVTPCFVSTFPVILDTLFKYWIFRHLNRTSPSIVATYHTMSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (TV-1), CF594 conjugate, 0.1mg/mL
BNC940029-500 1x 500 µL

Fibronectin (TV-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF568 conjugate, 0.1mg/mL
BNC680026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF555 conjugate, 0.1mg/mL
BNC551037-100 1x 100 µL

CD44 Standard (DF1485), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL
BNC680745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL
BNC740204-100 1x 100 µL

Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL
BNC470218-500 1x 500 µL

CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details