Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Innexin-11 (inx-11)

This Recombinant Innexin-11 (inx-11) spans the amino acid sequence from region 1-465.

Product Specifications

Product Name Alternative

Innexin-11, Protein opu-11

UniProt

Q23157

Expression Region

1-465

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVMIETFLGMAKYLSPREDDDWSDRLNYLMTPNILLAFSVLISFKQFGGRPIECMFPNKF PGSWEQYAENYCWSQDTYFVEPTQDVSLLKKEERYTPDRQLSYYQWVPFFLLLQAAFFRA PSYLWKYFSNHSGIRIHEVVEKAKDSANVEEEVREKNILILKRHLSSALRFQANMERKKV QVHKTVTFLNFQYSSGFISWIYLFTKVLYFLNVFAQLYLMNYFLGTNRHHWYGFGVVQDI VQGEPWERSGYFPRAAVCDFEVRQVANIQRYSVQCVLVINIFNEKIFVLLWFWYVILLLS STVSLVQWFIVLVFPCFSKWFVKQHLALSTLQNFNQRNSRREDSDVSKFVTQYLHKDGVF VLRMVSSHAGIIFATDLVQALYEAYDFQDKNKDVQGSPVSDDLQTISTGAESSIRQRKTR KGSRIEYKAGFPISTSLMPDKDDIESSSTSSEEDQKRVSNVITNI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc35f3 Mouse Gene Knockout Kit (CRISPR)
KN516074 1 Kit

Slc35f3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2428), CF740 conjugate, 0.1mg/mL
BNC742428-100 1x 100 µL

P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2428), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse IgG3 (Fcγ Fragment specific), AlpSdAbs® VHH
HA710258 100 µg

Mouse IgG3 (Fcγ Fragment specific), AlpSdAbs® VHH

Sign In for Pricing
View Details
Tissue Protein Lysate, Pancreas
CP605038 150 µg

Tissue Protein Lysate, Pancreas

Sign In for Pricing
View Details
Annexin A1 / (Hairy Cell Leukemia Marker) (6E4/3), CF488A conjugate, 0.1mg/mL
BNC882179-500 1x 500 µL

Annexin A1 / (Hairy Cell Leukemia Marker) (6E4/3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (CHGA) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8H7]
TA814055BM 100 µL

Chromogranin A (CHGA) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8H7]

Sign In for Pricing
View Details