Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anabaena variabilis Proton extrusion protein PcxA (pcxA)

This Recombinant Anabaena variabilis Proton extrusion protein PcxA (pcxA) spans the amino acid sequence from region 1-467.

Product Specifications

Product Name Alternative

Proton extrusion protein PcxA

UniProt

Q3MDY0

Expression Region

1-467

Origin

Anabaena variabilis (strain ATCC 29413 / PCC 7937)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPTMRNSIFSEKVYPILLSAYRWYLRTPERSLEEAYKAALNIKAIEDEHFNGNKIDFNSA IYSNSVMDYFESDLAQELKTARMRLTEFRFSRWFSNESHQKAARKAGIEYPSSTVILEKL KFIDEIISKYIITDYEIAAPSGASDLQVRTTSLQPPENPSLTDSLRNNDINKNNLVERIY TPTSPPQLIRPRTEQNKKPRGKADTTGILPRSILSTIGRLQIELDPNSEQDVINNFRQAQ KRSIISIRFILLLIIVPLLTHQLSKALIVSPIFNHFKKADTEQIFLNSEMEEEALSTLHR FEERIKFENLISNAPPLSAEAIETQIKEKAEEIAAEFRGESANAIKNVFADIFSVGAFIW LLLVSKPSIMVLKEFFDNVVYGLSDSAKAFIIILFTDVFVGFHSPHGWEVILEGLSRHWG LPANRDFIFLFIATFPVILDTIFKYWIFRYLNRISPSAVATYRNMNE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MPHOSPH10 (U3 Small Nucleolar Ribonucleoprotein Protein MPP10, M Phase Phosphoprotein 10, MPP10) (MaxLight 550)
MBS6212574-01 0.1 mL

MPHOSPH10 (U3 Small Nucleolar Ribonucleoprotein Protein MPP10, M Phase Phosphoprotein 10, MPP10) (MaxLight 550)

Sign In for Pricing
View Details
MPHOSPH10 (U3 Small Nucleolar Ribonucleoprotein Protein MPP10, M Phase Phosphoprotein 10, MPP10) (MaxLight 550)
MBS6212574-02 5x 0.1 mL

MPHOSPH10 (U3 Small Nucleolar Ribonucleoprotein Protein MPP10, M Phase Phosphoprotein 10, MPP10) (MaxLight 550)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Phosphoglycolate Phosphatase (PGP)
MBS2079758-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Phosphoglycolate Phosphatase (PGP)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Phosphoglycolate Phosphatase (PGP)
MBS2079758-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Phosphoglycolate Phosphatase (PGP)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Phosphoglycolate Phosphatase (PGP)
MBS2079758-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Phosphoglycolate Phosphatase (PGP)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Phosphoglycolate Phosphatase (PGP)
MBS2079758-04 1 mL

APC/CY7-Linked Polyclonal Antibody to Phosphoglycolate Phosphatase (PGP)

Sign In for Pricing
View Details