Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nostoc sp. Proton extrusion protein PcxA (pcxA)

This Recombinant Nostoc sp. Proton extrusion protein PcxA (pcxA) spans the amino acid sequence from region 1-467.

Product Specifications

Product Name Alternative

Proton extrusion protein PcxA

UniProt

Q8YWE0

Expression Region

1-467

Origin

Nostoc sp. (strain PCC 7120 / UTEX 2576)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPTMRNSIFSEKIYPILLSAYRWYLRTPERSLEEAYKAALNIKAIEDEHFNGNKIDFNSA IYSNSVMDYFESDLAQELKTARMRLTEFRFSRWFSNESHQKAARKAGIEYPSSNVTLEKL KFIDEVISKYIITDYEIVAPSGVSESQVRTTSSQPPENPSLTDALRTNDINKNNLVERIY TPTSPPQLIKQRTEQSKKSRGKADTTGILPRSILSTIGRLQIELDPNAEQDVINNFRQAQ KRSIISIRFILLIIIVPLLTHQLSKALIVSPIFNHFKNDHTEQIFLNSEMEEEALSTLHR FEERIKFENLISNAPPLSAEAIETQIKEKAEELAAEFRGESSNAIKNVFADIFSVGAFIW LLLVSKPSIMVLKEFFDNVVYGLSDSAKAFIIILFTDVFVGFHSPHGWEVILEGLSRHWG LPANRDFIFLFIATFPVILDTIFKYWIFRYLNRISPSAVATYRNMNE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Fibroblast Growth Factor 1, Acidic (FGF1) ELISA Kit
RD-FGF1-Mu-01 96 Tests

Mouse Fibroblast Growth Factor 1, Acidic (FGF1) ELISA Kit

Sign In for Pricing
View Details
Mouse Fibroblast Growth Factor 1, Acidic (FGF1) ELISA Kit
RD-FGF1-Mu-02 48 Tests

Mouse Fibroblast Growth Factor 1, Acidic (FGF1) ELISA Kit

Sign In for Pricing
View Details
EpCAM Antibody
F49189-0.08ML 0.08 mL

EpCAM Antibody

Sign In for Pricing
View Details
Syndecan 4 (SDC4) Rabbit Polyclonal Antibody
AP01356PU-N 100 µg

Syndecan 4 (SDC4) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Kinesin Family, Member 14 (KIF14) ELISA Kit
RDR-KIF14-Hu-01 96 Tests

Human Kinesin Family, Member 14 (KIF14) ELISA Kit

Sign In for Pricing
View Details
Human Kinesin Family, Member 14 (KIF14) ELISA Kit
RDR-KIF14-Hu-02 48 Tests

Human Kinesin Family, Member 14 (KIF14) ELISA Kit

Sign In for Pricing
View Details